Tap / click on image to see more RealViewsTM
£30.80
per window cling
 

Merry Christmas tree script stars family white Window Cling

Qty:
Personalise this template
18" x 24" (45.72cm x 60.96cm)
Automatic Opaque Design: White Underbase
Rectangle

Other designs from this category

About Window Clings

Sold by

Shape: Rectangle

Turn your glass surfaces into decorations, promotions, signage and more with custom window clings. These versatile and reusable vinyl clings stick to glass surfaces through static electricity so leave no sticky residue behind. From displaying new promotions on your business’s window and using that empty window space to boost your brand, to decorating a window in your home, you’ll find so many great uses for these clings.

  • Dynamically Sized - ranging from 10.16 cm x 10.16 cm (4” x 4”) to a max of 132.08 cm x 182.88 cm (52” x 72”) (or max 182.88 cm x 132.08 cm (72” x 52”) if horizontal/landscape is selected)
  • Material - 7.5 mil static cling vinyl
  • Non Adhesive: Sticks to glass surfaces electro-statically
  • Choose from rectangle or custom cut shapes

Application Instructions:

  • Clean the surface you wish to apply the window cling to with hot water and dishwasher soap and wait until dry
  • Next, apply a light mist of water to your surface. Peel the decal from backing paper and place it on your surface, slide it around until you’re happy with its placement
  • Once it’s positioned perfectly, use a squeegee or flat plastic card to remove any air bubbles and wipe your window dry
  • To reposition or remove, simply peel away. It’s non-adhesive so there’ll be no residue left on the surface

Print Process: Automatic Opaque Design: White Underbase

Art is printed on a transparent sheet of plastic, but white ink is printed beneath all art, making those areas opaqaue while also making colors vivid

Adhesive: Cling art faces inward

The adhesive side is on the back of the window cling. All text and art are printed on the front of the window cling and face towards the person applying it to the window. The art and text printed on the window cling will appear correctly when viewed from the same side of the window where it has been applied.

About This Design

Merry Christmas tree script stars family white Window Cling

Merry Christmas tree script stars family white Window Cling

A Very Merry Christmas modern trendy script in a Christmas tree shape decorated with stars.

Customer Reviews

3.6 out of 5 stars rating210 Total Reviews
122 total 5-star reviews11 total 4-star reviews8 total 3-star reviews10 total 2-star reviews59 total 1-star reviews
210 Reviews
Reviews for similar products
5 out of 5 stars rating
By mmmm A.29 August 2022Verified Purchase
Window Cling, Size: 8.00" x 11.00", Style: Partial Transparent Design: No Underbase, Shape: Custom Cut, Display: Back of Cling
Zazzle Reviewer Program
It was really easy to order this window cling for my business. Just uploaded my logo, picked the size etc and it turned up really promptly. Super easy to fit and it looks great! Excellent price as well! I'll definitely be back for more for my car! Perfect printing! All the colours were spot on and they really pop!
5 out of 5 stars rating
By Mr R.7 December 2022Verified Purchase
Window Cling, Size: 20.00" x 30.00", Style: Automatic Opaque Design: White Underbase, Shape: Rectangle, Display: Back of Cling
Zazzle Reviewer Program
good quality product. good quality print
5 out of 5 stars rating
By In S.28 December 2024Verified Purchase
Window Cling, Size: 4.00" x 4.00", Style: Partial Transparent Design: No Underbase, Shape: Custom Cut, Display: Back of Cling
Sharp detail print with bright colors. Looks good.

Tags

Window Clings
merry christmasholiday seasonelegantmodernstylishbusinessscriptcalligraphywhitefamily
All Products
merry christmasholiday seasonelegantmodernstylishbusinessscriptcalligraphywhitefamily

Other Info

Product ID: 256033959723426691
Created on 11/12/2021, 7:09
Rating: G