Tap / click on image to see more RealViewsTM
£14.40
per sticker
 

Minimalist Personalised Honemoon Hashtag Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Large 35.56 cm x 35.56 cm (14" x 14") Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 35.56 cm (14") L x 36.83 cm (14.5") H
  • Design Area: 35.56 cm (14") L x 35.56 cm (14") H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm (0.125") border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Minimalist Personalised Honemoon Hashtag Sticker

Minimalist Personalised Honemoon Hashtag Sticker

#honeymoonvibe hashtag sticker in modern calligraphy writing for suitcases, cars and more. Just add your names or any custom text. You can also add your own hashtag if you like, but may need to ajust the font size to make sure it fits. To do this click on "Edit using design tool".

Customer Reviews

4.1 out of 5 stars rating7 Total Reviews
3 total 5-star reviews3 total 4-star reviews0 total 3-star reviews1 total 2-star reviews0 total 1-star reviews
7 Reviews
Reviews for similar products
4 out of 5 stars rating
By Trevor C.6 January 2020Verified Purchase
Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
Was very impressed with the ordering and delivery of this item - it doesn’t show up very well on black for some reason - but looks very smart stuck on white! Exactly as I asked - the ordering process was very straightforward
5 out of 5 stars rating
By Caitlyn y.7 November 2022Verified Purchase
Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
These customizable stickers are fantastic! I used them for the groomsmen in my wedding and they turned out perfect. Looks just like the picture!
from zazzle.com (US)
5 out of 5 stars rating
By Erica E.3 February 2023Verified Purchase
Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
The finalized product was beautiful and perfect for what I needed it for. Printing was as described and the colors were vibrant!
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
scriptminimalistnewlywedsgifthoneymoontravelcouplejust marriedcustomnames
All Products
scriptminimalistnewlywedsgifthoneymoontravelcouplejust marriedcustomnames

Other Info

Product ID: 256290166934541049
Created on 29/11/2022, 0:36
Rating: G