Tap / click on image to see more RealViewsTM
£10.60
per sheet of 20
 

Mistletoe Holiday Wedding Square Sticker

Qty:
Square Stickers
+£0.40
+£0.40
+£0.40

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Mistletoe Holiday Wedding Square Sticker

Mistletoe Holiday Wedding Square Sticker

Watercolor mistletoe with classic and modern lettering sticker.

Customer Reviews

4.8 out of 5 stars rating4.2K Total Reviews
3579 total 5-star reviews394 total 4-star reviews99 total 3-star reviews48 total 2-star reviews67 total 1-star reviews
4,187 Reviews
Reviews for similar products
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Anonymous1 April 2026Verified Purchase
Simple yet perfect addition that finished off our wedding invites .
5 out of 5 stars rating
By Elaine P.15 July 2023Verified Purchase
Zazzle Reviewer Program
Easy to order. Good size. Print quality brilliant. Will use to label my crafting boxes so that they are easily identifiable when borrowed! Easy to design. Great choice. Quality exceptional. Thoroughly recommend

Tags

Stickers
holiday weddingeat drink and be marriedbe marriedmistletoewatercolorleavesgreeneryweddingchristmasfavour
All Products
holiday weddingeat drink and be marriedbe marriedmistletoewatercolorleavesgreeneryweddingchristmasfavour

Other Info

Product ID: 256290872858090446
Created on 29/11/2023, 3:57
Rating: G