Tap / click on image to see more RealViewsTM
The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
£26.60
per keychain
 

Monogram Gold Filigree Motif Key Chain

Qty:
Premium Square
-£14.60
-£15.25
-£14.60
+£0.65
Large (5.1 cm)

Other designs from this category

About Keychains

Sold by

Style: Premium Square Keychain

With this custom square keyring from Zazzle, You will never lose your keys or forget your favourite memory. The waterproof, UV coating will keep your images looking new for years to come and keep your memories fresh as if they happened yesterday!

  • Dimensions:
    • Measurements: 5.08 cm l x 5.08 cm (2" l x 2" w) w
    • Depth: 0.48 cm( 0.19")
    • Weight: 20 g (0.705 oz)
  • Full-colour, full-bleed printing
  • Silver-coloured metal charm & ring
  • UV resistant and waterproof
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 4.65 cm x 4.65 cm (1.83" x 1.83”). For best results please add 1.6 mm (1/16") bleed

About This Design

The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
Monogram Gold Filigree Motif Key Chain

Monogram Gold Filigree Motif Key Chain

*Customise with your text.

Customer Reviews

4.6 out of 5 stars rating5.6K Total Reviews
4313 total 5-star reviews810 total 4-star reviews220 total 3-star reviews116 total 2-star reviews102 total 1-star reviews
5,561 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous1 October 2025Verified Purchase
Premium Square Keychain, Large (2.00")
Very happy with my lovely new keyring, which was dispatched rapidly and delivered quick style! Excellent service! .
5 out of 5 stars rating
By E.24 December 2018Verified Purchase
Metal Circle Keychain, 2"
Zazzle Reviewer Program
The product itself self is absolutely lovely and a smart finish. I'm so pleased with it and think the recipient will be very pleased too! The writing is small so not very clear but that's fine the picture is the main focus anyway and Is really good quality.
5 out of 5 stars rating
By M.2 March 2023Verified Purchase
Metal Circle Keychain, 2"
Zazzle Reviewer Program
Good quality and beautiful! Very clever! Cool 😎

Tags

Keychains
monogramclassychicelegantprettyfiligreelacesquareblackgold
All Products
monogramclassychicelegantprettyfiligreelacesquareblackgold

Other Info

Product ID: 146482276042163762
Created on 17/06/2017, 19:53
Rating: G