Tap / click on image to see more RealViewsTM
£28.25
per shirt
 

MVK Fighting Together T-Shirt

Qty:
Basic T-Shirt
-£4.70
+£10.00
White
Classic Printing: No Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Men's Basic T-Shirt

Comfortable, casual and loose fitting, our heavyweight t-shirt will easily become a closet staple. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability.

Size & Fit

  • Model is 185 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold, tumble dry low
  • Imported

About This Design

MVK Fighting Together T-Shirt

MVK Fighting Together T-Shirt

Fighting Together supporting Mevalonate kinase deficiency (MVK disease)

Customer Reviews

4.6 out of 5 stars rating56.8K Total Reviews
43202 total 5-star reviews9439 total 4-star reviews2313 total 3-star reviews1033 total 2-star reviews812 total 1-star reviews
56,799 Reviews
Reviews for similar products
4 out of 5 stars rating
By John T.20 February 2014Verified Purchase
Basic T-Shirt, White, Adult L
Zazzle Reviewer Program
Delivery was just on the last day's of Delivery estimate,but within E.T.A just,So No complaints.Cotton is of Good Quality.Fit is Prerfect to 5% bigger. Very Good but Not perfect,but at Ordering would have taken V.Good AnyDay!!Only Slight thing(as NO Bleeding,NO Smudging or ANY probs with acctual writing,is that the Red/Black and T-Shirt Colour isn't as Bold/Bright as in picture.BUT! When i took pic's of T-Shirt on my Phone for this review,it again looked like Bolder/Brighter Colours by 10-15% than in reality.......
4 out of 5 stars rating
By Anonymous18 November 2024Verified Purchase
Basic T-Shirt, White, Adult L
I really like the design but I'm not sure the white base really took as you can see pink through her fur/bikini. So that was a little disappointing. That's more on the printing side though than the actual design, the design is really great, Cutey Bunny looks so beautiful! If you're thinking of getting this then I'd say just go for a white T-shirt and you should be fine.
5 out of 5 stars rating
By Shells A.26 March 2022Verified Purchase
Basic T-Shirt, Blue Horizon, Adult S
Zazzle Reviewer Program
Beautiful design and thick great quality cotton T Shirt with arty design. Very smart and comfortable to wear.. I highly recommend. The artist design is detailed and fantastic.

Tags

T-Shirts
fmfandaidglobalautoinflammatorydiseasesmevalonatekinasedeficiencymvkdisease
All Products
fmfandaidglobalautoinflammatorydiseasesmevalonatekinasedeficiencymvkdisease

Other Info

Product ID: 256138967277778890
Created on 23/10/2024, 0:28
Rating: G