Tap / click on image to see more RealViewsTM
£7.05
per sheet of 20
 

Painted wall panels in the Salon of Gille Square Sticker

Qty:
Square Stickers
+£0.30
+£0.30
+£0.30

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Painted wall panels in the Salon of Gille Square Sticker

Painted wall panels in the Salon of Gille Square Sticker

Painted wall panels in the Salon of Gille Demarteau | by Francois Boucher | Art Location: Musee de la Ville de Paris, Musee Carnavalet, Paris, France | French Artist | Image Collection Number: XIR211988

Customer Reviews

4.8 out of 5 stars rating27K Total Reviews
23427 total 5-star reviews2220 total 4-star reviews544 total 3-star reviews319 total 2-star reviews481 total 1-star reviews
26,991 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Tim S.23 October 2017Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
francoisboucher17thflemishengraverpanelswansswanbirdsfarmyard
All Products
francoisboucher17thflemishengraverpanelswansswanbirdsfarmyard

Other Info

Product ID: 217935399097204297
Created on 18/08/2011, 1:43
Rating: G