Sell on Zazzle
Tap / click on image to see more RealViewsTM
£14.70
per mug
 

Personalised Grandma Pink Coffee Mug

4.8 out of 5 stars rating
22542 Total Reviews |
by
Qty:
Style
Classic Mug
+£0.80
+£1.60
+£4.00
+£3.65
Size

Other designs from this category

About Mugs

Sold by
Mug
Create your own from scratch

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalise your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 325 ml or 443 ml
  • Dimensions:
    • 325 ml: 8.1 cm D x 9.7 cm H
    • 443 ml: 8.6 cm D x 11.4 cm H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Personalised Grandma Pink Coffee Mug

Personalised Grandma Pink Coffee Mug

This is a modern, personalised, Grandma mug with space to your grandchildren's names. It is in trending pink with stylish script typography. This chic design is ideal as a personalised gift for Grandma, or perfect to gift for yourself. To personalise simply add your names and year by using the personalise this text box. The rest of the text can also be changed here if needed. To change the colour or font check out the design editing tool. For any help with personalisation, matching products, or for a custom design, message me via zazzle chat.
Itsonlythemoon
Bronze
Artwork designed by
United Kingdom
View their Store

Customer Reviews

4.8 out of 5 stars rating22.5K Total Reviews
19879 total 5-star reviews1897 total 4-star reviews359 total 3-star reviews155 total 2-star reviews252 total 1-star reviews
22,542 Reviews
Reviews for similar products
5 out of 5 stars rating
By p.13 December 2016 • Verified Purchase
Combo Mug, 325 ml
Creator Review
I like to buy and review my own work to ensure you get an outstanding product and I’m happy to give the Primary Colours Beach Football Mug 5 stars because it meets my expectations completely. Pleased with it I am. Zazzle mugs are well fabricated, microwave and dishwasher safe. And this yellow red and blue panoramic wraparound motif is sealed with a durable and sparkling Orca polished gloss glaze finish. It’ll never rub off! The size and energy of two jostling figures and a burly goal keeper fit the mug's circular shape well. There's momentum in the carousel effect as the two jostling figures repeat and move right around the mug and meet a burly goal keeper. Big sharp original images precisely drawn and delicately captured in blue and red with plenty of bright yellow! An ideal gift for anyone who plays ball! A fun gift for all beachball and football fans. A pair with the Retro Grey-Grain Beachball Player Mug. Available in two sizes and several styles including Black Ringer, Travelling, and Stern. Go have a peek!
5 out of 5 stars rating
By Ruth B.6 July 2020 • Verified Purchase
Classic Mug, 325 ml
Creator Review
What a beautiful mug, I was really pleased with the mug. The printing was brilliant, wonderful colours
5 out of 5 stars rating
By Ruth B.31 August 2020 • Verified Purchase
Classic Mug, 325 ml
Creator Review
Love the colours and design of this mug. Printing is excellent

Tags

Mugs
grandmagrandmothermodernnanamumfamilykeepsakegrandchildrenwe love youpink
All Products
grandmagrandmothermodernnanamumfamilykeepsakegrandchildrenwe love youpink

Other Info

Product ID: 256367338314687259
Created on 24/05/2024, 8:54
Rating: G