Tap / click on image to see more RealViewsTM
£2.20
per sticker
 

Please Let Me Merge Before I Start Crying Bumper

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 7.62 cm (3") L x 8.89 cm (3.5") H
  • Design Area: 7.62 cm (3") L x 7.62 cm (3") H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm (0.125") border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

 Please Let Me Merge Before I Start Crying Bumper

Please Let Me Merge Before I Start Crying Bumper

Please Let Me Merge Before I Start Crying Bumper Sticker is a great funny bumper sticker for your vehicle.

Customer Reviews

4.6 out of 5 stars rating45 Total Reviews
39 total 5-star reviews1 total 4-star reviews1 total 3-star reviews1 total 2-star reviews3 total 1-star reviews
45 Reviews
Reviews for similar products
5 out of 5 stars rating
By K.19 December 2022Verified Purchase
Extra-Large 35.56 cm x 35.56 cm (14" x 14") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
Great quality car stickers and our logo image was beautifully printed. Very happy with the product. Logo to print was sharp / clear
5 out of 5 stars rating
By Avril O.6 January 2020Verified Purchase
Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
I love the cut-out shape of this sticker. I can put this schoolgirl on my stationery that I already have. All the colours reproduced perfectly- the delicate roses and the fine details oy eyes and tie are all there.
5 out of 5 stars rating
By Vicki P.28 October 2022Verified Purchase
Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
Good quality sticker, sticks well to the car window. Good quality printing, exactly as order preview

Tags

Custom-Cut Vinyl Stickers
pleaseletmemergebestiepleaseletmemergebumperbumperstickercarvehiclecardecalstraffic
All Products
pleaseletmemergebestiepleaseletmemergebumperbumperstickercarvehiclecardecalstraffic

Other Info

Product ID: 256844929465610093
Created on 31/12/2023, 9:01
Rating: G