Tap / click on image to see more RealViewsTM
£3.10
per sticker
 

Please Let Me Merge Before I Start Crying Bumper

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 7.6 cm L x 3.12.7 cm W
  • Design Area: 7.6 cm L x 7.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

 Please Let Me Merge Before I Start Crying Bumper

Please Let Me Merge Before I Start Crying Bumper

Please Let Me Merge Before I Start Crying Bumper Sticker is a great funny bumper sticker for your vehicle.

Customer Reviews

4.4 out of 5 stars rating49 Total Reviews
40 total 5-star reviews2 total 4-star reviews1 total 3-star reviews1 total 2-star reviews5 total 1-star reviews
49 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By K.19 December 2022Verified Purchase
Extra-Large 35.56 cm x 35.56 cm (14" x 14") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
Great quality car stickers and our logo image was beautifully printed. Very happy with the product. Logo to print was sharp / clear
5.0 out of 5 stars rating
5 out of 5 stars rating
By Avril O.6 January 2020Verified Purchase
Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
I love the cut-out shape of this sticker. I can put this schoolgirl on my stationery that I already have. All the colours reproduced perfectly- the delicate roses and the fine details oy eyes and tie are all there.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Vicki P.28 October 2022Verified Purchase
Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
Good quality sticker, sticks well to the car window. Good quality printing, exactly as order preview

Tags

Custom-Cut Vinyl Stickers
pleaseletmemergebestiepleaseletmemergebumperbumperstickercarvehiclecardecalstraffic
All Products
pleaseletmemergebestiepleaseletmemergebumperbumperstickercarvehiclecardecalstraffic

Other Info

Product ID: 256844929465610093
Created on 31/12/2023, 9:01
Rating: G