Tap / click on image to see more RealViewsTM
£39.00
per clipboard
 

Pretty Pink Floral Script Monogram Initial Name Clipboard

Qty:
Personalise this template

Other designs from this category

About Clipboard

Sold by

Style: Clipboard

Stay organised, and stunningly stylish, with custom clipboards from Zazzle! Use your favourite design, images or text to transform this basic school supply into a stunning accessory, that will keep you on track, always!

  • Dimensions: 31.75 cm L x 22.86 cm W (12.5" x 9"); thickness: 0.31 cm (0.125")
  • Designed for letter and A4 sized paper
  • Holds up to 1.27 cm (0.5") of paper securely
  • Made of ultra-durable acrylic
  • Printed on both sides
  • /!\WARNING: CHOKING HAZARD - small parts.
  • Not for children under 3 yrs.

About This Design

Pretty Pink Floral Script Monogram Initial Name Clipboard

Pretty Pink Floral Script Monogram Initial Name Clipboard

Pretty, modern and elegant, this trendy clipboard design features a hand painted watercolor floral motif in the corner, with your name and monogram initial in pink and soft grey hand lettered script typography, and is bordered in matching pink. Copyright Anastasia Surridge for Personalised Home Decor, all rights reserved.

Customer Reviews

4.9 out of 5 stars rating392 Total Reviews
354 total 5-star reviews27 total 4-star reviews4 total 3-star reviews6 total 2-star reviews1 total 1-star reviews
392 Reviews
Reviews for similar products
5 out of 5 stars rating
By Heather C.3 December 2018Verified Purchase
Clipboard
Zazzle Reviewer Program
I love the sparkly background that the designer made, I personalized it for my JP business so I can use it for work and it showcases my business name and team name. Hopefully when I can afford it, and I get some teamies as well. I will buy one for them too as a gift like other team leaders gives their teamies things to give back and encourage them. I can also use it to hold my notes when I go to local, national and abroad events. It is great quality and well made. The printing is awesome, it's bright and clear. It's printed on both sides really well. Just what I wanted. The board is very sturdy as well.
5 out of 5 stars rating
By A.18 March 2018Verified Purchase
Clipboard
Zazzle Reviewer Program
I wanted something different for my personal trainers birthday and found this funny clipboard.He absolutely loves it !Very pleased. Printing is excellent
5 out of 5 stars rating
By Patricia t.26 August 2023Verified Purchase
Clipboard
Zazzle Reviewer Program
I just wish it had a extra gloss texture to shine but I love it anyway!!! Thanks so much !!! .
from zazzle.com (US)

Tags

Clipboard
pinkgirlyprettychicscriptelegantinitialnamefloralmonogram
All Products
pinkgirlyprettychicscriptelegantinitialnamefloralmonogram

Other Info

Product ID: 256132108931783769
Created on 20/10/2021, 17:13
Rating: G