Sell on Zazzle
Tap / click on image to see more RealViewsTM
The jewel details are simulated in the artwork. No actual jewels or rhinestones will be used in the making of this product.
£11.85
per sheet of 20
 

PRINTED RIBBON Silver, Teal Damask Wedding Sticker

4.8 out of 5 stars rating
4189 Total Reviews |
by
Wedding Collection
Qty:
Shape
Square Stickers
+£0.45
+£0.45
+£0.45
Size
Paper Type

Other designs from this category

Shop this collection

Vicki Smith
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

About Stickers

Sold by
Sticker
Create your own from scratch

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

The jewel details are simulated in the artwork. No actual jewels or rhinestones will be used in the making of this product.
PRINTED RIBBON Silver, Teal Damask Wedding Sticker

PRINTED RIBBON Silver, Teal Damask Wedding Sticker

This 1.5" square silver grey and teal damask wedding favour thank you sticker and/or envelope seal has a PRINTED satin look ribbon and a PRINTED diamond jewels buckle on it that matches the wedding invitation shown below. Other shapes and sizes are also available. ****PLEASE use caution if you change fonts or the shape of the sticker, as the safe area is quite large on the stickers, so your text may get cut-off if it extends into the safe area. For best results, email niteowlstudio@gmail.com if you want a different shape sticker. These also come in 3" sizes if you need something larger.
NiteOwl Studio Inc.
Diamond
Artwork designed by
Nova Scotia, Canada
View their Store

Customer Reviews

4.8 out of 5 stars rating4.2K Total Reviews
3580 total 5-star reviews395 total 4-star reviews99 total 3-star reviews48 total 2-star reviews67 total 1-star reviews
4,189 Reviews
Reviews for similar products
5 out of 5 stars rating
By Carolyn S.17 August 2020 • Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Anonymous1 April 2026 • Verified Purchase
Simple yet perfect addition that finished off our wedding invites .
5 out of 5 stars rating
By Elaine P.15 July 2023 • Verified Purchase
Zazzle Reviewer Program
Easy to order. Good size. Print quality brilliant. Will use to label my crafting boxes so that they are easily identifiable when borrowed! Easy to design. Great choice. Quality exceptional. Thoroughly recommend

Tags

Stickers
tealsilverdamaskgreyweddingfavoursfall weddingwinter weddingsummer weddingturquoise
All Products
tealsilverdamaskgreyweddingfavoursfall weddingwinter weddingsummer weddingturquoise

Other Info

Product ID: 217323152008396479
Created on 12/05/2012, 18:31
Rating: G