Tap / click on image to see more RealViewsTM
The jewel details are simulated in the artwork. No actual jewels or rhinestones will be used in the making of this product.
£8.85
per sheet of 20
 

PRINTED RIBBON Silver, Teal Damask Wedding Sticker

Qty:
Square Stickers
+£0.40
+£0.40
+£0.40

Other designs from this category

Shop this collection

 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

The jewel details are simulated in the artwork. No actual jewels or rhinestones will be used in the making of this product.
PRINTED RIBBON Silver, Teal Damask Wedding Sticker

PRINTED RIBBON Silver, Teal Damask Wedding Sticker

This 1.5" square silver grey and teal damask wedding favour thank you sticker and/or envelope seal has a PRINTED satin look ribbon and a PRINTED diamond jewels buckle on it that matches the wedding invitation shown below. Other shapes and sizes are also available. ****PLEASE use caution if you change fonts or the shape of the sticker, as the safe area is quite large on the stickers, so your text may get cut-off if it extends into the safe area. For best results, email niteowlstudio@gmail.com if you want a different shape sticker. These also come in 3" sizes if you need something larger.

Customer Reviews

4.8 out of 5 stars rating4.1K Total Reviews
3557 total 5-star reviews391 total 4-star reviews93 total 3-star reviews39 total 2-star reviews59 total 1-star reviews
4,139 Reviews
Reviews for similar products
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Elaine P.15 July 2023Verified Purchase
Zazzle Reviewer Program
Easy to order. Good size. Print quality brilliant. Will use to label my crafting boxes so that they are easily identifiable when borrowed! Easy to design. Great choice. Quality exceptional. Thoroughly recommend
5 out of 5 stars rating
By Carolyn S.20 May 2018Verified Purchase
Zazzle Reviewer Program
These classy stickers sit well on products they look good, the ink, quality of paper & glue enhances the durability of the product . I would recommend these. The printing is high quality, the style is vintage which is the look I was going for

Tags

Stickers
tealsilverdamaskgreyweddingfavoursfall weddingwinter weddingsummer weddingturquoise
All Products
tealsilverdamaskgreyweddingfavoursfall weddingwinter weddingsummer weddingturquoise

Other Info

Product ID: 217323152008396479
Created on 12/05/2012, 18:31
Rating: G