Tap / click on image to see more RealViewsTM
£43.75
per set of 50 napkins
 

Purple Pink Blue Butterfly Bridal Shower Napkin

Qty:
White

Other designs from this category

Shop this collection

Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Paper Napkins

Sold by

Style: Standard Cocktail

A good celebration is as much about the presentation as it is about food. Serve up the party with custom personalised paper napkins that look good tucked in the collar or draped over your lap.

  • Dimensions: 12 cm l x 12 w cm (folded), 3 ply
  • Printed in full colour on your choice of white or ecru coloured napkins
  • Coined or standard napkin styles available
  • Sold in quantities of 50
  • Buy in bulk and save!
  • This product is food contact safe
Tip: When ordering napkins, the general rule is 3 napkins per guest.

About This Design

Purple Pink Blue Butterfly Bridal Shower Napkin

Purple Pink Blue Butterfly Bridal Shower Napkin

Personalise this exquisite Butterfly Bridal Shower Paper Napkin, a charming addition to your celebration. Embrace the whimsical beauty of fluttering pink, blue, and purple butterflies delicately adorned against a crisp white background. Each napkin is adorned with soft tones, featuring delicate white flowers intertwined with the elegant butterfly motif, creating a picturesque scene that exudes both femininity and grace. Featuring a boho floral design, these paper napkins effortlessly elevate any bridal shower decor, adding a touch of enchantment and sophistication to your event. Whether you're hosting a bridal shower party, picnic or a lavish affair, these pretty napkins are sure to impress your guests with their timeless elegance.

Customer Reviews

4.7 out of 5 stars rating1.3K Total Reviews
1124 total 5-star reviews92 total 4-star reviews34 total 3-star reviews26 total 2-star reviews49 total 1-star reviews
1,325 Reviews
Reviews for similar products
5 out of 5 stars rating
By M.25 September 2023Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
From start to finish the experience with your company was superb. Once serviettes had a arrived (on time) the quality and over all end product was excellent really pleased. Printing on product was clear and beautifully done.
5 out of 5 stars rating
By nathan p.3 October 2019Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
The quality of this item is outstanding! The detailing on the item is perfect, what you see online is what you get very happy!! Amazing printing can’t even see a pixel very clean and perfect detailing what you see is what you get!!
5 out of 5 stars rating
By Patricia D.11 March 2024Verified Purchase
Paper Napkins, Standard Cocktail
I bought these napkins to wrap pieces of individual cake in. I was so pleased with them. They were everything I expected and more. So pretty and of good quality too. I would definitely recommend this seller. The printing was amazing. The colours were fantastic. Delighted with them.

Tags

Paper Napkins
butterfly bridal showerpurplepinkblueboho floralflowersbridal showercalligraphywhimsicalfeminine
All Products
butterfly bridal showerpurplepinkblueboho floralflowersbridal showercalligraphywhimsicalfeminine

Other Info

Product ID: 256280182806499442
Created on 10/09/2024, 3:06
Rating: G