Sell on Zazzle
Tap / click on image to see more RealViewsTM
£7.20
per sticker
 

Red ensign Australian flag pre 1954 navy army

4.7 out of 5 stars rating
43 Total Reviews |
by
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl Sticker
Create your own from scratch

Sticker Sheet Size: Medium 15.24 cm x 15.24cm (6" x 6") Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 15.24 cm (6") L x 16.51 cm (6.5") H
  • Design Area: 15.24 cm (6") L x 15.24 cm (6") H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm (0.125") border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Red ensign Australian flag pre 1954 navy army

Red ensign Australian flag pre 1954 navy army

The red ensign was widely used as the civil flag of Australia up until 1954, when it was changed by prime minister Robert Menzies in a campaign against the communist 'reds'. This is the flag that was taken to battle in both world wars.
Stickies
Bronze
Artwork designed by
Brisbane, Queensland, Australia
View their Store

Customer Reviews

4.7 out of 5 stars rating43 Total Reviews
38 total 5-star reviews1 total 4-star reviews1 total 3-star reviews0 total 2-star reviews3 total 1-star reviews
43 Reviews
Reviews for similar products
5 out of 5 stars rating
By K.19 December 2022 • Verified Purchase
Extra-Large 35.56 cm x 35.56 cm (14" x 14") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
Great quality car stickers and our logo image was beautifully printed. Very happy with the product. Logo to print was sharp / clear
5 out of 5 stars rating
By Avril O.6 January 2020 • Verified Purchase
Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
I love the cut-out shape of this sticker. I can put this schoolgirl on my stationery that I already have. All the colours reproduced perfectly- the delicate roses and the fine details oy eyes and tie are all there.
5 out of 5 stars rating
By Vicki P.28 October 2022 • Verified Purchase
Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
Good quality sticker, sticks well to the car window. Good quality printing, exactly as order preview

Tags

Custom-Cut Vinyl Stickers
australian flagred ensignaustraliaaustralianflagarmynavyensignflagsstickies
All Products
australian flagred ensignaustraliaaustralianflagarmynavyensignflagsstickies

Other Info

Product ID: 256181510643727300
Created on 04/06/2019, 18:35
Rating: G