Tap / click on image to see more RealViewsTM
£14.80
per mug
 

Red Panda Coffee Mug

Qty:
Personalise this template
Classic Mug
+£1.05
+£2.15
+£5.60
+£6.65
+£10.90

Other designs from this category

About Mugs

Sold by

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalise your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 325 ml or 443 ml
  • Dimensions:
    • 325 ml: 8.1 cm D x 9.7 cm H
    • 443 ml: 8.6 cm D x 11.4 cm H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Red Panda Coffee Mug

Red Panda Coffee Mug

A digital painting of a Red Panda on a tree branch. Add your own text on the reverse side. The red panda (Ailurus fulgens, or shining-cat), which resembles a racoon, lives in the cool temperate bamboo forests in Sichuan and Yunnan Provinces in China, in the Himalayas, and in Myanmar. Locations with the highest density of red pandas include an area in the Himalayas that has been proposed as having been a refuge for a variety of endemic species in the Pleistocene. Red pandas were once thought to be closely related to the giant panda, but genetics has shown they are more closely allied with the racoon and weasel families. The animal is now considered a living fossil and only distantly related to the Giant Panda (Ailuropoda melanoleuca) , with which they share part of their range. Their common ancestor can be traced back to the Early Tertiary Period tens of millions of years ago, with a wide distribution across Eurasia. In 2004, a tooth from a red panda species never before recorded in North America was discovered at the Grey Fossil Site in Tennessee. The tooth dates from 4.5–7 million years ago. In August 2010, archaeologists uncovered red panda fossil remains in Washington County in the US state of Tennessee. Although none are known to exist in the wild in North America today, it is believed the red panda thrived in the mountains of eastern Tennessee approximately 4.5 million years ago. Slightly larger than a domestic cat, it has reddish-brown fur, a long, shaggy tail, and a waddling gait due to its short front legs. The average lifespan is 8–10 years, but individuals have been known to reach 15 years. They weigh between seven and 14 pounds. Their red-and-white markings blend in with the red mosses and white lichens that grow on the trees in which they live. Their soft, dense fur covers their entire body—even the soles of their feet. Secretive and gentle creatures, adults are solitary except during mating season. They are generally quiet except for some twittering, tweeting, and whistling communication sounds. They have been reported to be both nocturnal and crepuscular, sleeping on tree branches or in tree hollows during the day and increasing their activity in the late afternoon and early evening hours. They sleep stretched out on a branch with legs dangling when it is hot, and curled up with its tail over the face when it is cold. They are very heat sensitive, with an optimal “well-being” temperature between 63 and 77 °F, and cannot tolerate temperatures over 77 °F. Shortly after waking, red pandas clean their fur like a cat, licking their front paws and then rubbing their back, stomach and sides. They also rub their back and belly along the sides of trees or rocks. Then they patrol their territory, marking it with urine and a weak musk-smelling secretion from their anal gland. They search for food running along the ground or through the trees. Red pandas may alternately either use their forepaws to bring food to their mouth or place food directly into the mouth. Like the Giant Panda, they cannot digest cellulose, so they must consume a large volume of bamboo to survive. Their diet consists of about two-thirds bamboo, but they also eat mushrooms, roots, acorns, lichen, and grasses. Occasionally, they supplement their diet with fish and insects. They do little more than eat and sleep due to their low-calorie diet. Their broad teeth and strong jaws allow them to chew bamboo's tough leaves and stalks. The animals share another characteristic with the giant panda, they have a small, bony projection on their wrists, a “false thumb,' that helps them grip bamboo stalks. Reproduction: After a gestation of about 134 days, litters of one to four young are born. Young stay in the nest for about 90 days, remain close to their mother until the next mating season begins, and reach adult size at about 12 months. Adult red pandas lead solitary lives. Conservation: Red pandas are listed as vulnerable on the IUCN Red List of Threatened Species because of habitat loss. Worldwide population estimates range from fewer than 2,500 individuals to between 16,000 and 20,000 individuals. Although red pandas are protected by national laws in their range countries, their numbers in the wild continue to decline mainly due to habitat loss and fragmentation, poaching, and inbreeding depression. Predators of the red panda include the snow leopard, martens (Mustelidae), and humans. If they feel threatened or sense danger, they may try to escape by climbing a rock column or tree. If they can no longer flee, they stand on their hind legs to make themselves appear larger and use the sharp claws on their front paws to defend themselves. The primary threats to red pandas are direct harvest from the wild, live or dead, competition with domestic livestock resulting in habitat degradation, and deforestation resulting in habitat loss or fragmentation. The relative importance of these factors is different in each region, and is not well understood.For instance, in India the biggest threat seems to be habitat loss followed by poaching, while in China the biggest threat seems to be hunting and poaching. A 40% decrease in red panda populations has been reported in China over the last 50 years, and populations in western Himalayan areas are considered to be lower. Deforestation can inhibit the spread of red pandas and exacerbate the natural population subdivision by topography and ecology, leading to severe fragmentation of the remaining wild population. Fewer than 40 animals in 4 separate groups share resources with humans in Nepal's Langtang National Park, where only 6% of 660 sq mi is preferred red panda habitat. Although direct competition for food with domestic livestock is not significant, livestock can depress bamboo growth by trampling. Small groups of animals with little opportunity for exchange between them face the risk of inbreeding, decreased genetic diversity, and even extinction. In addition, clearcutting for firewood or agriculture, including hillside terracing, removes old trees that provide maternal dens and decreases the ability of some species of bamboo to regenerate. In Southwest China, red pandas are hunted for their fur, especially for the highly valued bushy tails from which hats are produced. In these areas, the fur is often used for local cultural ceremonies, and in weddings the bridegroom traditionally carries the hide. The "good-luck charm" red panda-tail hats are also used by local newlyweds. Because the red panda is considered a very attractive animal, and is not much larger than a house cat, it would seem to be ideal for a pet. Despite this, and despite reports that Indira Gandhi kept red pandas as pets when she was a child, there does not seem to have ever been widespread adoption of these animals as pets. Due to its listing in CITES Appendix I, obtaining a red panda as a pet would now be quite difficult. Interestingly, due to the red panda's high levels of captive breeding and recent successful efforts of domestication by selective breeding of the red fox, domestication could be possible. However, because of their low tolerances for high temperature areas, the red panda if ever domesticated may not be suitable as pets in some areas or special care would be needed to keep them happy. Though there is growing interest in the general public of the availability of this animal as a pet, there does not appear to be any person or group attempting to domestic the red panda through any process including selective breeding. Domestication may also be a viable method of successful conservation though it should not be the only form.

Customer Reviews

4.8 out of 5 stars rating22.2K Total Reviews
19577 total 5-star reviews1883 total 4-star reviews341 total 3-star reviews139 total 2-star reviews212 total 1-star reviews
22,152 Reviews
Reviews for similar products
5 out of 5 stars rating
By p.13 December 2016Verified Purchase
Combo Mug, 325 ml
Creator Review
I like to buy and review my own work to ensure you get an outstanding product and I’m happy to give the Primary Colours Beach Football Mug 5 stars because it meets my expectations completely. Pleased with it I am. Zazzle mugs are well fabricated, microwave and dishwasher safe. And this yellow red and blue panoramic wraparound motif is sealed with a durable and sparkling Orca polished gloss glaze finish. It’ll never rub off! The size and energy of two jostling figures and a burly goal keeper fit the mug's circular shape well. There's momentum in the carousel effect as the two jostling figures repeat and move right around the mug and meet a burly goal keeper. Big sharp original images precisely drawn and delicately captured in blue and red with plenty of bright yellow! An ideal gift for anyone who plays ball! A fun gift for all beachball and football fans. A pair with the Retro Grey-Grain Beachball Player Mug. Available in two sizes and several styles including Black Ringer, Travelling, and Stern. Go have a peek!
5 out of 5 stars rating
By Ruth B.6 July 2020Verified Purchase
Classic Mug, 325 ml
Creator Review
What a beautiful mug, I was really pleased with the mug. The printing was brilliant, wonderful colours
5 out of 5 stars rating
By Ruth B.31 August 2020Verified Purchase
Classic Mug, 325 ml
Creator Review
Love the colours and design of this mug. Printing is excellent

Tags

Mugs
pandared pandalesser pandahimalayaschinanepalanimalswildlifenatureanimal gifts
All Products
pandared pandalesser pandahimalayaschinanepalanimalswildlifenatureanimal gifts

Other Info

Product ID: 168979684914534511
Created on 24/08/2015, 0:42
Rating: G