Tap / click on image to see more RealViewsTM
Sale Price £25.88.  
Original Price £34.50 per shirt
You save 25%

Riding the Wave to Success T-shirt

Qty:
Basic Dark T-Shirt
-£1.65
+£5.80
Black
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark colour t-shirt will quickly become one of your favorites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customise it to make it uniquely yours!

Size & Fit

  • Model is 188 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Riding the Wave to Success T-shirt

Riding the Wave to Success T-shirt

This t-shirt design features a line graph that climbs steadily up a mountain peak, reaching the summit. The design is perfect for new trading graphics designers who are looking to show off their skills and determination. The mountain motif represents the challenges and rewards of trading, while the line graph symbolises success.

Customer Reviews

4.7 out of 5 stars rating32.9K Total Reviews
25740 total 5-star reviews5059 total 4-star reviews1131 total 3-star reviews496 total 2-star reviews471 total 1-star reviews
32,897 Reviews
Reviews for similar products
5 out of 5 stars rating
By Joan B.26 April 2021Verified Purchase
Basic Dark T-Shirt, Black, Adult L
Zazzle Reviewer Program
I give wanted to give this a 4 instead of a 5 because these Basic DARK T0shirts run unexpectedly SLIM or Narrow. Which is great if you do not have a potbelly, but I have a paunch. It isn't the shirt's fault that I've got a beer belly. The design and shirt itself is a quality cotton shirt. The color is more of a deep purple, but still a very pretty color. The Basic DARK T-shirts run a bit SLIMMER than the Basic Ts. The neck is a fraction narrower (or seems to be narrower) also. I'm a paunchy middle-aged woman and my neck is 12 inches (31cm) thick and the neckline fell about the same as in the photo of the man, and I had the desire to tug it a bit. So if you're a thick necked man or like loose shirts, be aware these are slimmer shirts. Once I get rid of my lockdown paunch it'll look great. The shirt washed well in cold water with no apparent bleeding. We don't have a dryer, so it hung dry. Did not shrink. Love the colors and the design. The design looks smaller on my shirt than it does on the model on-line. But still, it looks good on the shirt. The printing looks as it does on the model, just the size seems fractionally smaller. Washed garment in cold water, hung dry and design appeared unaffected.
5 out of 5 stars rating
By Katalin B.27 May 2019Verified Purchase
Basic Dark T-Shirt, Brown, Adult S
Creator Review
Thank you very much, it is a very great product! Excellent quality, thank you!
5 out of 5 stars rating
By manlio c.3 January 2022Verified Purchase
Basic Dark T-Shirt, Dark Grey, Adult L
Zazzle Reviewer Program
great print quality and excellent tissue. I am very satisfied with the final result is just as I had imagined and as it was visible in the preview on the site

Tags

T-Shirts
tradinggraphicstshirtdesignnewdesigneefinancialmarketsmountainmotiflinegraphsuccesstiger
All Products
tradinggraphicstshirtdesignnewdesigneefinancialmarketsmountainmotiflinegraphsuccesstiger

Other Info

Product ID: 256145644063570158
Created on 29/03/2024, 23:27
Rating: G