Tap / click on image to see more RealViewsTM
£34.50
per shirt
 

Riding the Wave to Success T-shirt

Qty:
Basic Dark T-Shirt
-£1.65
+£5.80
Black
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark colour t-shirt will quickly become one of your favorites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customise it to make it uniquely yours!

Size & Fit

  • Model is 188 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Riding the Wave to Success T-shirt

Riding the Wave to Success T-shirt

This t-shirt design features a line graph that climbs steadily up a mountain peak, reaching the summit. The design is perfect for new trading graphics designers who are looking to show off their skills and determination. The mountain motif represents the challenges and rewards of trading, while the line graph symbolises success.

Customer Reviews

4.7 out of 5 stars rating32.6K Total Reviews
25540 total 5-star reviews5047 total 4-star reviews1111 total 3-star reviews483 total 2-star reviews455 total 1-star reviews
32,636 Reviews
Reviews for similar products
5 out of 5 stars rating
By Joan B.26 April 2021Verified Purchase
Basic Dark T-Shirt, Black, Adult L
Zazzle Reviewer Program
I give wanted to give this a 4 instead of a 5 because these Basic DARK T0shirts run unexpectedly SLIM or Narrow. Which is great if you do not have a potbelly, but I have a paunch. It isn't the shirt's fault that I've got a beer belly. The design and shirt itself is a quality cotton shirt. The color is more of a deep purple, but still a very pretty color. The Basic DARK T-shirts run a bit SLIMMER than the Basic Ts. The neck is a fraction narrower (or seems to be narrower) also. I'm a paunchy middle-aged woman and my neck is 12 inches (31cm) thick and the neckline fell about the same as in the photo of the man, and I had the desire to tug it a bit. So if you're a thick necked man or like loose shirts, be aware these are slimmer shirts. Once I get rid of my lockdown paunch it'll look great. The shirt washed well in cold water with no apparent bleeding. We don't have a dryer, so it hung dry. Did not shrink. Love the colors and the design. The design looks smaller on my shirt than it does on the model on-line. But still, it looks good on the shirt. The printing looks as it does on the model, just the size seems fractionally smaller. Washed garment in cold water, hung dry and design appeared unaffected.
5 out of 5 stars rating
By Katalin B.27 May 2019Verified Purchase
Basic Dark T-Shirt, Brown, Adult S
Creator Review
Thank you very much, it is a very great product! Excellent quality, thank you!
5 out of 5 stars rating
By Mark S.14 December 2017Verified Purchase
Basic Dark T-Shirt, Black, Adult L
Creator Review
I'm wearing this as I type... It's fab! Lovely quality. Soft material, perfect fit, nice and warm (It is very cold here, I live at the top of a hill and the wind is brutal in winter). Couldn't be happier with this. My Girlfriend really likes it as well - always a bonus! I was really impressed by how the printing turned out - my photo's don't do it justice. This is a complex design with a lot of colour variations but the finished article is really impressive. I couldn't be happier with how this has turned out. This is also one of my first designs to have been purchased by someone else (thank you so much!) I'm really curious to know what they think of the finished product...

Tags

T-Shirts
tradinggraphicstshirtdesignnewdesigneefinancialmarketsmountainmotiflinegraphsuccesstiger
All Products
tradinggraphicstshirtdesignnewdesigneefinancialmarketsmountainmotiflinegraphsuccesstiger

Other Info

Product ID: 256145644063570158
Created on 29/03/2024, 23:27
Rating: G