Tap / click on image to see more RealViewsTM
The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
£7.05
per sheet of 20
 

RUSTIC LACE | WEDDING FAVOR LABELS

Qty:
Square Stickers
+£0.30
+£0.30
+£0.30

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
RUSTIC LACE | WEDDING FAVOR LABELS

RUSTIC LACE | WEDDING FAVOR LABELS

com com com com com. com

Customer Reviews

4.8 out of 5 stars rating4.1K Total Reviews
3544 total 5-star reviews391 total 4-star reviews93 total 3-star reviews39 total 2-star reviews59 total 1-star reviews
4,126 Reviews
5 out of 5 stars rating
By N.1 September 2015Verified Purchase
Zazzle Reviewer Program
The stickers fit perfect on my white favor boxes. They give a wonderful personalized touch without breaking the bank. It's perfect! Small enough to fit, but large enough to read
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Elaine P.15 July 2023Verified Purchase
Zazzle Reviewer Program
Easy to order. Good size. Print quality brilliant. Will use to label my crafting boxes so that they are easily identifiable when borrowed! Easy to design. Great choice. Quality exceptional. Thoroughly recommend

Tags

Stickers
rusticlaceweddingvintagekraftcraftpaperwhitebrownscript
All Products
rusticlaceweddingvintagekraftcraftpaperwhitebrownscript

Other Info

Product ID: 217689049614070603
Created on 09/05/2013, 7:36
Rating: G