Sell on Zazzle
Tap / click on image to see more RealViewsTM
£6.90
per sticker
 

Saigon Ho Chi Minh City HCMC Vietnam Sunset

4.8 out of 5 stars rating
24 Total Reviews |
by
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl Sticker
Create your own from scratch

Sticker Sheet Size: Medium 15.24 cm x 15.24cm (6" x 6") Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 15.24 cm (6") L x 16.51 cm (6.5") H
  • Design Area: 15.24 cm (6") L x 15.24 cm (6") H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm (0.125") border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Saigon Ho Chi Minh City HCMC Vietnam Sunset

Saigon Ho Chi Minh City HCMC Vietnam Sunset

Saigon or Ho Chi Minh City skyline in Vietnam with sunset cityscape souvenir for Southeast Asia vacation. Saigon Ho Chi Minh City with Skyline in Vietnam as a souvenir for Asia and HCMC. Saigon Sunset Ho Chi Minh City Panorama Lifestyle for Urban Backpackers and Vietnamese City Trip. Saigon Panorama Ho Chi Minh City in Southeast Asia and Vietnam sunset cityscape design souvenir. Saigon Ho Chi Minh City city design for travel to HCMC and Asia or South Vietnam. Saigon Ho Chi Minh City with skyline for Vietnam vacation. You can easily customise and personalise the design by enter the name you want.
Photography Gift
Bronze
Artwork designed by
Germany
View their Store

Customer Reviews

4.8 out of 5 stars rating24 Total Reviews
21 total 5-star reviews2 total 4-star reviews0 total 3-star reviews0 total 2-star reviews1 total 1-star reviews
24 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kim K.7 July 2020 • Verified Purchase
Extra-Large 35.56 cm x 35.56 cm (14" x 14") Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Nice design and quality product. Excellent quality, exactly what was ordered
5 out of 5 stars rating
By Chandler A.23 August 2023 • Verified Purchase
Small 10.16 cm x 10.16 cm (4" x 4") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
The decal is perfect...it arrived ahead of schedule, was well priced and functions as a nice give away for our customers. It adheres well too. Chandler. Great job...the printing is very clear...
from zazzle.com (US)
5 out of 5 stars rating
By SAIR A.9 January 2025 • Verified Purchase
Large 20.32 cm x 20.32 cm (8" x 8") Sheet Custom-Cut Vinyl Stickers, Matte White
My first time trying Zazzle and Zazzle is amazing. The stickers are awesome and this is very good for business.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
saigonho chi minh cityskylinevietnamcityscapehcmcsunsetpanoramaretrocity
All Products
saigonho chi minh cityskylinevietnamcityscapehcmcsunsetpanoramaretrocity

Other Info

Product ID: 256998807896294676
Created on 17/06/2023, 5:33
Rating: G