Tap / click on image to see more RealViewsTM
£3.95
per sticker
 

Saucer Girl Vinyl

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Small 10.16 cm x 10.16 cm (4" x 4") Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 10.16 cm (4") L x 11.43 cm (4.5") H
  • Design Area: 10.16 cm (4") L x 10.16 cm (4") H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm (0.125") border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Saucer Girl Vinyl

Saucer Girl Vinyl

TSM's logo, now a sticker for your enjoyment

Customer Reviews

4.4 out of 5 stars rating48 Total Reviews
39 total 5-star reviews2 total 4-star reviews1 total 3-star reviews1 total 2-star reviews5 total 1-star reviews
48 Reviews
Reviews for similar products
5 out of 5 stars rating
By K.19 December 2022Verified Purchase
Extra-Large 35.56 cm x 35.56 cm (14" x 14") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
Great quality car stickers and our logo image was beautifully printed. Very happy with the product. Logo to print was sharp / clear
5 out of 5 stars rating
By Avril O.6 January 2020Verified Purchase
Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
I love the cut-out shape of this sticker. I can put this schoolgirl on my stationery that I already have. All the colours reproduced perfectly- the delicate roses and the fine details oy eyes and tie are all there.
5 out of 5 stars rating
By Vicki P.28 October 2022Verified Purchase
Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
Good quality sticker, sticks well to the car window. Good quality printing, exactly as order preview

Tags

Custom-Cut Vinyl Stickers
transskiingsaucerboymemesskiertransgenderflagpridequeer
All Products
transskiingsaucerboymemesskiertransgenderflagpridequeer

Other Info

Product ID: 256219171966573410
Created on 19/01/2022, 16:01
Rating: G