Sell on Zazzle
Tap / click on image to see more RealViewsTM
£6.15
per sticker
 

Sedna (2003 VB12)

4.5 out of 5 stars rating
1131 Total Reviews |
by
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl StickerCreate your own from scratch

Sticker Sheet Size: Small 10.16 cm x 10.16 cm (4" x 4") Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 10.2 cm L x 4.12.7 cm W
  • Design Area: 10.2 cm L x 10.2 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Sedna (2003 VB12)

Sedna (2003 VB12)

Sedna is an unofficial dwarf planet that orbits in the outer regions of the solar system. While it takes over 12,000 years to complete its orbit, it will be at it's closest aproach in 2071. Sedna's unusual orbit may be evidence for another planet in our solar system, known as planet 9 or planet X. Sedna is the Inuit goddess of sea creatures. Image created in procreate.
OrchardSCIENCE
Silver
Artwork designed by
Vancouver, BC, Canada
View their Store

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
922 total 5-star reviews66 total 4-star reviews27 total 3-star reviews29 total 2-star reviews87 total 1-star reviews
1,131 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kevin L.29 March 2021 • Verified Purchase
Extra-Large 35.56 cm x 35.56 cm (14" x 14") Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
These stickers look and feel fantastic. The material is in a matte finish, and is the biggest size print (Extra-Large 35.6 x 35.6 cm). I love the bright colours. I’m super happy with all the prints had come out. It gives us great confidence of the products. The colours are bright and colourful and don’t run (something I was really worried about), and the look of them feels great.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Rebecca B.27 February 2024 • Verified Purchase
Zazzle Reviewer Program
Really beautiful decal sticker verse, Love how easy it is to take off and that some of the verse are not all together which gave me flexibility to move them about, came really quickly and safely in secure protective sturdy packaging, very happy with product ⭐️⭐️⭐️⭐️⭐️. Printing was great very clear and great quality
5.0 out of 5 stars rating
5 out of 5 stars rating
By Rebecca B.27 February 2024 • Verified Purchase
Zazzle Reviewer Program
Really beautiful decal sticker verse, Love how easy it is to take off and that some of the verse are not all together which gave me flexibility to move them about, came really quickly and safely in secure protective sturdy packaging, very happy with product ⭐️⭐️⭐️⭐️⭐️. Excellent quality and Very clear printing Love how some of the verse was separate really happy

Tags

Custom-Cut Vinyl Stickers
spaceastronomysolar systemsednaredplanetdwarfplanet 9inuitdata
All Products
spaceastronomysolar systemsednaredplanetdwarfplanet 9inuitdata

Other Info

Product ID: 256437812644068238
Created on 19/08/2023, 11:31
Rating: G