Tap / click on image to see more RealViewsTM
£6.70
per sheet of 20
 

You betray yourself when forget those who betrayed square sticker

Qty:
Square Stickers
+£0.25
+£0.25
+£0.25

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

You betray yourself when forget those who betrayed square sticker

You betray yourself when forget those who betrayed square sticker

you forget those who betrayed” sticker. Featuring bold typography and a striking design, it’s perfect for laptops, notebooks, water bottles, and planners. Durable, high-quality print to keep the message alive. you betray yourself sticker, life lesson quote sticker, motivational vinyl decal, self respect sticker, bold typography design, inspirational laptop sticker, water bottle quote decal,

Customer Reviews

4.8 out of 5 stars rating27K Total Reviews
23419 total 5-star reviews2220 total 4-star reviews543 total 3-star reviews318 total 2-star reviews478 total 1-star reviews
26,978 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Tim S.23 October 2017Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
lifelessonquotestickermotivationalvinyldecalselfrespectstickerboldtypographystickerinspirationallaptopstickerwaterbottlequotestickerdeepmessagestickerawarenessstickerdesign
All Products
lifelessonquotestickermotivationalvinyldecalselfrespectstickerboldtypographystickerinspirationallaptopstickerwaterbottlequotestickerdeepmessagestickerawarenessstickerdesign

Other Info

Product ID: 256525084411549454
Created on 11/08/2025, 21:04
Rating: G