Sell on Zazzle
Tap / click on image to see more RealViewsTM
£3.60
per sticker
 

Serving Sunshine -Sunny Pastel Pickleball Life 2pc

4.6 out of 5 stars rating
1068 Total Reviews |
by
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl Sticker
Create your own from scratch

Sticker Sheet Size: Extra-Small 7.62 cm x 7.62cm (3" x 3") Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 7.62 cm (3") L x 8.89 cm (3.5") H
  • Design Area: 7.62 cm (3") L x 7.62 cm (3") H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm (0.125") border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Serving Sunshine -Sunny Pastel Pickleball Life 2pc

Serving Sunshine -Sunny Pastel Pickleball Life 2pc

"Serving Up Sunshine" features a pastel pink and yellow paddle with an orange pickleball. The cheerful orange motivational text is completed with a rising sun. Show off your love for pickleball with this fun 2pc sticker set. These cute graphics will make a great statement sticker for your car, cooler, water bottle, laptop, notebook and more! • Available in glossy white, matte white, and transparent. Transparent stickers show best on light surfaces. For darker items, a white sticker base is recommended for better visibility and contrast. •
Fun and Pun Design Co
Artwork designed by
Gulf Coast, FL, United States
View their Store

Customer Reviews

4.6 out of 5 stars rating1.1K Total Reviews
896 total 5-star reviews64 total 4-star reviews24 total 3-star reviews20 total 2-star reviews64 total 1-star reviews
1,068 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kevin L.29 March 2021 • Verified Purchase
Extra-Large 35.56 cm x 35.56 cm (14" x 14") Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
These stickers look and feel fantastic. The material is in a matte finish, and is the biggest size print (Extra-Large 35.6 x 35.6 cm). I love the bright colours. I’m super happy with all the prints had come out. It gives us great confidence of the products. The colours are bright and colourful and don’t run (something I was really worried about), and the look of them feels great.
5 out of 5 stars rating
By Rebecca B.27 February 2024 • Verified Purchase
Zazzle Reviewer Program
Really beautiful decal sticker verse, Love how easy it is to take off and that some of the verse are not all together which gave me flexibility to move them about, came really quickly and safely in secure protective sturdy packaging, very happy with product ⭐️⭐️⭐️⭐️⭐️. Printing was great very clear and great quality
5 out of 5 stars rating
By Rebecca B.27 February 2024 • Verified Purchase
Zazzle Reviewer Program
Really beautiful decal sticker verse, Love how easy it is to take off and that some of the verse are not all together which gave me flexibility to move them about, came really quickly and safely in secure protective sturdy packaging, very happy with product ⭐️⭐️⭐️⭐️⭐️. Excellent quality and Very clear printing Love how some of the verse was separate really happy

Tags

Custom-Cut Vinyl Stickers
pickleballpickleball accessoriespickleball fanaticstickervinylpastelpickleball playergraphicsunshinesun
All Products
pickleballpickleball accessoriespickleball fanaticstickervinylpastelpickleball playergraphicsunshinesun

Other Info

Product ID: 256516365808571688
Created on 28/12/2025, 9:32
Rating: G