Tap / click on image to see more RealViewsTM
The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
£32.60
per pack of 100
 

Silver Frame / Cursive Typography Business Card

Qty:
Squared
+£6.15
Standard Semi-Gloss

16 pt thickness / 400 GSM weight
Bright white, semi-gloss finish

+£7.80
+£7.80
+£7.80
+£15.60
+£15.60
+£15.60
+£15.60
+£15.60
+£15.60
+£29.50

Other designs from this category

About Business Cards

Sold by

Size: UK / Euro, 85 mm x 55 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Standard European business card size, ideal for EU countries
  • Dimensions: 85 mm x 55 mm
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Standard Semi-Gloss

Our most versatile and economical paper, Standard Semi-Gloss produces crisp, vibrant images with exceptional colour and detail—a solid choice for all your printing needs.

  • 16 pt thickness / 400 GSM weight
  • Bright white, semi-gloss finish
  • 50% recycled content
  • Paper imported from Italy

About This Design

The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
Silver Frame / Cursive Typography Business Card

Silver Frame / Cursive Typography Business Card

Add your text and company information on these template ready business cards. Recommended best on a heavy stock paper for higher print quality and more protective substrate. For any design requests contact the designer. ©2010 Joshua Martin

Customer Reviews

4.7 out of 5 stars rating39.2K Total Reviews
32847 total 5-star reviews3880 total 4-star reviews977 total 3-star reviews596 total 2-star reviews922 total 1-star reviews
39,222 Reviews
Reviews for similar products
5 out of 5 stars rating
By keeley l.25 March 2024Verified Purchase
Business Card, Size: Mighty, 89 mm x 64 mm,Paper: Standard Semi-Gloss, Corners: Squared
I absolutely love ordering cards for my jewellery business from Zazzle. I especially love the earring cards as they have the holes pre marked ready for me to punch and apply my earrings. I’m now looking to get the round stickers with my business name and logo on. Amazing service. Printing was perfect exactly what I was looking for.
5 out of 5 stars rating
By Marta W.15 February 2022Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Standard Semi-Gloss, Corners: Squared
Zazzle Reviewer Program
The product it’s great, great graphics and colours, I loved that I could made this card on my own way, just like I wanted. The cards came out fabulous I love it so much.
5 out of 5 stars rating
By Tina B.3 January 2021Verified Purchase
Business Card, Size: UK / Euro, 85 mm x 55 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
The Zazzle business card design tool was excellent, easy to use and offering plenty of options. I wanted a card ln portrait with space to display my jewellery and my logo. The basic Zazzle cards are great quality and sturdy enough to take a necklace and earrings without buckling. A little pricey, but worth it to have my own design, as I wanted it. Thank you Zazzle. My image contains extremely fine script and delicate colouring. Zazzle reproduced these precisely and without any fuzz or blur. Colour was as expected, even though it was hard to choose sometimes as monitors vary.

Tags

Business Cards
fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance
All Products
fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance

Other Info

Product ID: 256917464780544705
Created on 05/03/2020, 10:15
Rating: G