Tap / click on image to see more RealViewsTM
Sale Price £2.16.  
Original Price £2.87 per card
You save 25%

Simple Black and White Script Save The Date

Qty:
Choose Your Format
Squared
+£0.20
+£0.24
+£0.24
+£0.24
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+£1.49
+£0.64
+£0.64
-£0.16

Other designs from this category

About Flat Save The Date Cards

Sold by

Size: 12.7 cm x 17.8 cm

Hip hip hooray, it's time to spread the good cheer; a date so important you have to save it!

  • Dimensions: 12.7 cm L x 17.8 cm H (portrait); 17.8 cm L x 12.7 cm H (landscape)
  • High-quality, full-colour, full-bleed printing on both sides
  • Add personal photos and text for no additional upcharge
  • Envelopes included but can be removed if not needed

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Simple Black and White Script Save The Date

Simple Black and White Script Save The Date

This simple black and white save the date card features a pretty script save the date with a leaf motif, set above your details in an elegant modern text.

Customer Reviews

4.8 out of 5 stars rating2.4K Total Reviews
2152 total 5-star reviews207 total 4-star reviews39 total 3-star reviews18 total 2-star reviews23 total 1-star reviews
2,439 Reviews
Reviews for similar products
5 out of 5 stars rating
By Alicia M.23 January 2022Verified Purchase
Zazzle Reviewer Program
Great quality considering we had the standard cars and printing. 100% recommend, feel more expensive than they are. Loved the quality of the print, colours are exactly what we wanted.
Original product
5 out of 5 stars rating
By Tracy S.16 February 2019Verified Purchase
Flat Save The Date Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
The higher grade matte paper looks gives a more sophisticated look to the stationary than the basic paper. Lovely print. It is great that you can change the font
5 out of 5 stars rating
By Hayley J.14 July 2023Verified Purchase
Flat Save The Date Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
These sage the dates were perfect and came exactly the way they looked on the screen. I was a bit apprehensive on the colour as all the sage green I order always seems to be a little different but this colour was the perfect match. The quality of the card it was printed on was also great, didn’t feel cheap. Great quality printing, card felt nice and thick.

Tags

Flat Save The Date Cards
save the date weddinganniversary save the dateengagement save the datescriptblack and whitesimplechicelegantstylishleaf motif
All Products
save the date weddinganniversary save the dateengagement save the datescriptblack and whitesimplechicelegantstylishleaf motif

Other Info

Product ID: 256766060584492636
Created on 05/12/2019, 8:50
Rating: G