Tap / click on image to see more RealViewsTM
£20.45
per roll
 

Small Dark Green Angel Minimalist Merry Christmas Wrapping Paper

Qty:
Personalise this template

Other designs from this category

About Wrapping Paper

Sold by

Paper Finish: Matte Wrapping Paper

Make sure every gift you give has a layer of love by creating custom wrapping paper. Available in four types of premium paper and five different sizes, our wrapping paper covers all your gift wrapping needs - because presentation matters as much as the gift!

  • 64lb print quality matte paper
  • Ideal for printing photos
  • Full colour edge-to-edge printing
  • Width: 74 cm
  • Length: multiple options from 1.8 m to 18.3 m
  • Each roll up to 4.6 m in length; lengths greater than 4.6 m shipped as multiple 4.6 m rolls
  • Length guide:
    • 1.8 m roll wraps 3 shirt-sized boxes
    • 4.6 m roll wraps 9 shirt-sized boxes
    • 9.1 m roll wraps 18 shirt-sized boxes
    • 13.7 m roll wraps 27 shirt-sized boxes
    • 18.3 m roll wraps 36 shirt-sized boxes
  • Designable area is 91 x 76 cm, but scaled down uniformly and printed at 88.4 x 73.7 cm
  • Please note: Designs are tiled after first 88.4 x 73.7 cm printed section

About This Design

Small Dark Green Angel Minimalist Merry Christmas  Wrapping Paper

Small Dark Green Angel Minimalist Merry Christmas Wrapping Paper

Celebrate the season wrapped in deep green elegance, adorned with a delicate small angel motif symbolizing connection and pride. Ideal for family, friends, or office gifts. Customize the “Merry Christmas” text easily to create a personal, heartfelt message. Wrap your gift in meaningful festive charm today!

Customer Reviews

4.7 out of 5 stars rating4K Total Reviews
3391 total 5-star reviews377 total 4-star reviews111 total 3-star reviews69 total 2-star reviews84 total 1-star reviews
4,032 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jan T.18 August 2025Verified Purchase
Wrapping Paper, Matte Wrapping Paper
I love this paper and it was large enough to put on the back of a glazed cabinet. It’s had lots of comments. I painted the interior to extend the image and it was very pleased with the result.
5 out of 5 stars rating
By Julia M.24 May 2017Verified Purchase
Zazzle Reviewer Program
I really liked this product, the picture is lovely and the colours are really nice. I wanted it to up-cycle a writing bureau and I was concerned that the paper may be too thin. But it wasn't and it worked fine. On the pictures I have uploaded the print looks a bit aged and not so vivid and new looking. As I wanted an aged patina but the actual print is clearer and the colours are brighter. The colour and prints are good.
Original product
5 out of 5 stars rating
By B.20 October 2017Verified Purchase
Wrapping Paper, Matte Wrapping Paper
Zazzle Reviewer Program
Very strong quality paper used. I used it to cover a lampshade, and it looks stunning now. Vibrant and vivid. Such lovely colours.

Tags

Wrapping Paper
darkgreengiftwrapsmallangelchristmasdesigneditableholidaytypographyminimalistgreenwrappingelegantfestivewrappersonalizedholidaypapercustomchristmastextstylishfamilygiftingsophisticatedgreenwrapholidaytrenddeepgreen
All Products
darkgreengiftwrapsmallangelchristmasdesigneditableholidaytypographyminimalistgreenwrappingelegantfestivewrappersonalizedholidaypapercustomchristmastextstylishfamilygiftingsophisticatedgreenwrapholidaytrenddeepgreen

Other Info

Product ID: 256221165159002170
Created on 24/10/2025, 3:55
Rating: G