Tap / click on image to see more RealViewsTM
£15.50
per mug
 

Sniper Just Because I'm A Mile Away Doesn't Mean Coffee Mug

Qty:
Classic Mug
+£0.90
+£1.70
+£4.20
+£3.90

Other designs from this category

About Mugs

Sold by

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalise your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 325 ml or 443 ml
  • Dimensions:
    • 325 ml: 8.1 cm D x 9.7 cm H
    • 443 ml: 8.6 cm D x 11.4 cm H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Sniper Just Because I'm A Mile Away Doesn't Mean Coffee Mug

Sniper Just Because I'm A Mile Away Doesn't Mean Coffee Mug

Sniper Just Because I'm A Mile Away Doesn't Mean I'm Not Watching Your Back

Customer Reviews

4.8 out of 5 stars rating22.6K Total Reviews
19887 total 5-star reviews1898 total 4-star reviews360 total 3-star reviews156 total 2-star reviews252 total 1-star reviews
22,553 Reviews
Reviews for similar products
5 out of 5 stars rating
By p.13 December 2016Verified Purchase
Combo Mug, 325 ml
Creator Review
I like to buy and review my own work to ensure you get an outstanding product and I’m happy to give the Primary Colours Beach Football Mug 5 stars because it meets my expectations completely. Pleased with it I am. Zazzle mugs are well fabricated, microwave and dishwasher safe. And this yellow red and blue panoramic wraparound motif is sealed with a durable and sparkling Orca polished gloss glaze finish. It’ll never rub off! The size and energy of two jostling figures and a burly goal keeper fit the mug's circular shape well. There's momentum in the carousel effect as the two jostling figures repeat and move right around the mug and meet a burly goal keeper. Big sharp original images precisely drawn and delicately captured in blue and red with plenty of bright yellow! An ideal gift for anyone who plays ball! A fun gift for all beachball and football fans. A pair with the Retro Grey-Grain Beachball Player Mug. Available in two sizes and several styles including Black Ringer, Travelling, and Stern. Go have a peek!
5 out of 5 stars rating
By Ruth B.6 July 2020Verified Purchase
Classic Mug, 325 ml
Creator Review
What a beautiful mug, I was really pleased with the mug. The printing was brilliant, wonderful colours
5 out of 5 stars rating
By Ruth B.31 August 2020Verified Purchase
Classic Mug, 325 ml
Creator Review
Love the colours and design of this mug. Printing is excellent

Tags

Mugs
semperfidelisreconiraqsnipermilitaryeagleveteranscoutamerica
All Products
semperfidelisreconiraqsnipermilitaryeagleveteranscoutamerica

Other Info

Product ID: 168195560353740120
Created on 30/04/2012, 7:07
Rating: G