Tap / click on image to see more RealViewsTM
£9.00
per sheet of 20
 

Swirling Elemental Nebula Abstract Square Sticker

Qty:
Square Stickers
+£0.30
+£0.30
+£0.30

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Swirling Elemental Nebula Abstract Square Sticker

Swirling Elemental Nebula Abstract Square Sticker

Immerse yourself in the mesmerizing beauty of this swirling abstract masterpiece. This striking design features an intricate maze of textured, impasto-style brushstrokes that cleverly mimic the fluid dynamics of cosmic nebulas, roaring fires, and deep ocean currents. The dynamic contrast between the fiercely glowing oranges and yellows and the cool, mysterious blues and purples creates a breathtaking visual experience. Every inch of this artwork is packed with hypnotic, spiraling energy that effortlessly draws the eye. Perfect for making a bold statement, this vividly colored, highly detailed pattern looks absolutely incredible on print-on-demand apparel like cut-and-sew t-shirts, vibrant wall art, or unique everyday accessories. Elevate your wardrobe and living space with this captivating, psychedelic burst of elemental energy that bridges the gap between classic fine art textures and modern digital surrealism.

Customer Reviews

4.8 out of 5 stars rating27.4K Total Reviews
23720 total 5-star reviews2236 total 4-star reviews575 total 3-star reviews366 total 2-star reviews546 total 1-star reviews
27,443 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tim S.23 October 2017Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
smokepsychedelicdynamicwavesmesmerizingartyellowpurpleglowingchaotic
All Products
smokepsychedelicdynamicwavesmesmerizingartyellowpurpleglowingchaotic

Other Info

Product ID: 256720923103479354
Created on 24/06/2026, 7:34
Rating: G