Tap / click on image to see more RealViewsTM
£29.28
each
 

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

Qty:

Other designs from this category

About Towels

Sold by

Style: Bath Towel

Turn your bathroom into your own personal oasis with a custom towel perfect for drying you off in style. Towel set is a great gift for many occasions.

  • Dimensions: 76.2 cm x 152.4 cm (30" x 60")
  • Material: front is a polyester blend, back is 100% cotton
  • Sublimation printing allows for vibrant printing designed to last
  • Machine washable, tumble dry on low

About This Design

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

Symmetric Pink Flower Tiled Pattern on Sage Bath Towel

My design features a beautiful tiled, pink flower motif, within a mosaic frame. This is a repeated, symmetrical pattern placed on a soft sage green, background. Adding a personalized name makes a charming gift idea. This item can be given a personalized name, with the design tool. Change the text and font to a style and color of your choice.

Customer Reviews

4.4 out of 5 stars rating570 Total Reviews
431 total 5-star reviews53 total 4-star reviews21 total 3-star reviews22 total 2-star reviews43 total 1-star reviews
570 Reviews
Reviews for similar products
5 out of 5 stars rating
By Carolyn G.29 November 2021Verified Purchase
Hand Towel
Zazzle Reviewer Program
Present for my mums yoga studio. Very soft and beautiful hand towel. Extremely happy with the overall service, delivery and communication. I was able to track my parcel.from the minute the order was placed. Arrived faster than expected as being sent from u.s.a to northern ireland. Thanks again Zazzle!! Towel turned out exactly as pictured in my order. Highly recommended. A+
5 out of 5 stars rating
By Ruth S.26 January 2021Verified Purchase
Wash Cloth
Zazzle Reviewer Program
Excellent. Great reproduction of the image provided. Great quality material used for both items. The printing was outstanding on both items from a small image. Even thought the two items were different in size there was no distortion or deterioration in the finished product. There was a warning prior to placing the order that the image might not reproduce well to the size requested but I took a chance and was not disappointed. Very impressed. Very pleased with my goods.
5 out of 5 stars rating
By Josie M.7 February 2021Verified Purchase
Bathroom Towel Set
Zazzle Reviewer Program
Love these towels,good quality,but a bit to thick to dry with. Colour and printing was excellent

Tags

Towels
flowerpatternpinkgreennamesymmetrictilesagemotifmosaic
All Products
flowerpatternpinkgreennamesymmetrictilesagemotifmosaic

Other Info

Product ID: 256053667625050057
Created on 01/02/2024, 3:29
Rating: G