Tap / click on image to see more RealViewsTM
Sale Price £2.84.  
Original Price £3.78 per card
You save 25%

Thank You for Help Vintage Girl & Cat

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+£0.67
-£0.18
Vertical

Other designs from this category

About Folded Thank You Cards

Sold by

Size: Standard, 12.7 cm x 17.8 cm

Be obsessively grateful! Custom thank you cards for small things, big things, and everything in between.

  • Dimensions: 12.7 cm x 17.78 cm (5"x 7")(portrait or landscape)
  • Full colour CMYK print process
  • Double-sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Thank You for Help Vintage Girl & Cat

Thank You for Help Vintage Girl & Cat

This sweet illustration of a girl feeding her cat is the perfect way to say thank you for your help. Image is from Graphics Fairy and is in the public domain. Public-Domain-Download-Girl-Cat-GraphicsFairy

Customer Reviews

4.8 out of 5 stars rating3.7K Total Reviews
3365 total 5-star reviews256 total 4-star reviews51 total 3-star reviews27 total 2-star reviews37 total 1-star reviews
3,736 Reviews
Reviews for similar products
5 out of 5 stars rating
By Alisha C.19 November 2021Verified Purchase
Folded Thank You Card, Size: Small, 10.2 cm x 14.2 cm, Paper: Signature Matte
Zazzle Reviewer Program
The product was just what we wanted as a thank you card for those that have supported us in moving into our first home. You could personalise every detail of it and the quality is just perfect! I love it. It also said delivery was 9-18 days with the ‘slow service’ which was fine for us. I ordered on the Tuesday and it arrived on the Friday! Just amazing, thanks so much. Will definitely be purchasing again. Printing quality is excellent, I got the matte finish and it looks amazing! Can’t fault it.
5 out of 5 stars rating
By R.23 August 2020Verified Purchase
Folded Thank You Card, Size: Small, 10.2 cm x 14.2 cm, Paper: Signature Matte
Zazzle Reviewer Program
Really good quality. I had some questions and the communication with the Zazzle team was great. I will definitely use Zazzle again for my other designs. The colours are true to the design and the finish is nice.
5 out of 5 stars rating
By D.14 August 2020Verified Purchase
Folded Thank You Card, Size: Small, 10.2 cm x 14.2 cm, Paper: Signature Matte
Zazzle Reviewer Program
Beautiful card of abstract sunflowers, which I am using to send to a friend to let them know I am thinking of them. The printing is very good, the sunflowers have that soft watercolour appeal, very dreamy.

Tags

Folded Thank You Cards
thankyouhelpvintagegirlcatfeedingmilksaucerbowl
All Products
thankyouhelpvintagegirlcatfeedingmilksaucerbowl

Other Info

Product ID: 137663167239947182
Created on 19/05/2015, 5:48
Rating: G