Tap / click on image to see more RealViewsTM
£17.90
per tile
 

The Griffin's Plume Tile

Qty:
15.24 cm x 15.24 cm
Frame and Keepsake Boxes available
Starting from £4.75
Select your accessory options after adding to cart

Other designs from this category

About Tiles

Sold by

Size: 15.24 cm x 15.24 cm

Display your favorite photos, images, and quotes on this vibrant ceramic tile. You can use your custom tile as a trivet or to upgrade your home décor. Great for holiday, wedding, and office gifts.

  • Dimensions: 15.24cm L x 15.24cm W; Thickness: 0.5cm
  • Weight: 241g.
  • Made of white ceramic
  • Full-color, full-bleed printing
  • Intended for residential use. Suitable for dry or low-moisture indoor wall applications with brief exposure to water (such as backsplashes which are properly sealed and grouted). Not suitable for use on floors. Not suitable for constantly wet areas (like showers). Protect from exposure to direct sunlight. Not frost resistant.
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 15.24cm x 15.24cm. For best results please add 0.3cm bleed

About This Design

The Griffin's Plume Tile

The Griffin's Plume Tile

Close-up shot of an ornate, decorative tile design. The design features a central, fan-like motif with alternating sections of light purple and light orange. This fan is framed by a green border that curves around the top and sides, with decorative swirls at the bottom corners. The border is further embellished with gold accents, particularly at the top and bottom.

Customer Reviews

4.8 out of 5 stars rating1.1K Total Reviews
968 total 5-star reviews63 total 4-star reviews19 total 3-star reviews10 total 2-star reviews10 total 1-star reviews
1,070 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Robert H.12 August 2020Verified Purchase
Ceramic Tile, 10.80 cm x 10.80 cm
Zazzle Reviewer Program
thank you so much , love this so glad i chose it , very pleased with how it looks brilliant, and very quick delivery. the printing was brilliant so clear and very bright , putting these as a feature in my bathroom , very pleased indeed thank you so much for your lovely work, ps do you do these in 12 inch as my friend would like that size , kind regards robert harris .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Barry C.4 October 2022Verified Purchase
Ceramic Tile, 15.24 cm x 15.24 cm
Zazzle Reviewer Program
Really nice image fixed to the tiles in my shower as a background to a soap dish. This was to hide the marks left by a broken soap dish. Just used tile adhesive and white grout. I think it looks good, almost like the drips are falling from the soap dish. No probs. Nice image.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lizzie B.16 October 2021Verified Purchase
Ceramic Tile, 15.24 cm x 15.24 cm
Zazzle Reviewer Program
My heart skipped a beat when I found this collection of Art Nouveau designs. I have created a fireplace where there was none. Amazing. The tiles were exactly as depicted

Tags

Tiles
artdecoplumeshellpinkgreenwhitevintageceramictile
All Products
artdecoplumeshellpinkgreenwhitevintageceramictile

Other Info

Product ID: 256697075007500530
Created on 10/10/2025, 22:49
Rating: G