Tap / click on image to see more RealViewsTM
£7.45
per sheet of 20
 

Trendy Grey Damask and Pink for a Baby Shower Square Sticker

Qty:
Square Stickers
+£0.35
+£0.35
+£0.35

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Trendy Grey Damask and Pink for a Baby Shower Square Sticker

Trendy Grey Damask and Pink for a Baby Shower Square Sticker

Sticker Seals. Trendy Grey Damask and Pink for a Baby Shower. ⭐This Product is 100% Customisable. Graphics and text can be deleted, moved, resized, changed around, rotated, etc... ⭐99% of my designs in my store are done in layers. This makes it easy for you to resize and move the graphics and text around so that it will fit each product perfectly. 📌(Please be sure to resize or move graphics if needed before ordering) You can also "TRANSFER DESIGN" on other Zazzle products and adjust the design to fit most of Zazzle items. (button is down on the right side of the page) Some of the text graphics have ready to fill in the box(es) or you can Click on the "CUSTOMIZE" button to add, move, delete, resize, background colour or change any of the font or graphics. The design is made with high resolution vector and/or digital graphics for a professional print. 📌NOTE: (THIS IS A PRINT. All Zazzle product designs are "prints" unless otherwise stated under "About This Product" area) The design will be printed EXACTLY like you see it on the screen and on the product...so please make sure when you do your changes on the resizing of any of the graphics or text that it fits in the areas correctly and that your spelling and wording is how you like it to be in size, colour and font. If you have any questions about the "DESIGN ONLY" or need help please contact me at my direct email - ✉siggyscott@comcast.net or visit my store link: https://www.zazzle.com/store/designsbydonnasiggy (Copy and Paste) I'll be happy to help. ⭐ ALL OTHER QUESTIONS (such as the shipping, a refund, the printing is incorrect, or the product itself, etc...) PLEASE CONTACT ZAZZLE OR THE MAKER ⭐DIRECTLY⭐. Thank you for the support and stopping by my store - DesignsbyDonnaSiggy. © Donna Siegrist⭐⭐⭐ ZAZZLE promises 100% satisfaction.

Customer Reviews

4.8 out of 5 stars rating26.7K Total Reviews
23210 total 5-star reviews2206 total 4-star reviews519 total 3-star reviews290 total 2-star reviews440 total 1-star reviews
26,665 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Tim S.23 October 2017Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
All Products
baby showersealsgreypinkwhiteelegantdamaskbaby girltagscute

Other Info

Product ID: 217889338338523437
Created on 26/04/2015, 22:36
Rating: G