Tap / click on image to see more RealViewsTM
£75.15
per pair of leggings
 

Tropical Parrot Birds All Over Print Leggings

Qty:

Other designs from this category

About Leggings

Sold by

Style: Leggings

Style and comfort make these the perfect pair of leggings. Custom-made with care; each pair is printed before being sewn, allowing for fun designs on every square inch. These leggings won't lose their shape so get comfy and look cool with your own unique pair.

Due to the cut-and-sew nature of each pair of leggings, designs, and prints may not match up at the seams. We do not recommend designs with words printed on or across the seam as they are hard to match precisely by even the most skilled of dressmakers.

Size & Fit

  • Full length leggings
  • Model is 5'10" (178 cm) and wearing a size S
  • Compression fit due to high spandex content; our leggings hug in all the right places and suit all body types

Fabric & Care

  • Material: Ultra-stretch polyester spandex blend. Legging is 79% polyester, 21% spandex. Capri is 88% polyester, 12% spandex
  • Sturdy, breathable, and stretches to fit your body
  • High spandex composition means compression fit won't lose shape; hugs in all the right places and bounces back after washing
  • Machine wash cold, gentle cycle. Or hand wash. Tumble dry medium heat. Do not bleach
  • Vibrant print won't fade after washing
  • Hand sewn in Canada

About This Design

Tropical Parrot Birds All Over Print Leggings

Tropical Parrot Birds All Over Print Leggings

Awesome collage of vintage botanical fine art of exotic tropical Parrot Birds and habitat Pods, etc., is on these great All Over Print Leggings. Image is public domain due to expired copyright.

Customer Reviews

4.8 out of 5 stars rating847 Total Reviews
727 total 5-star reviews90 total 4-star reviews15 total 3-star reviews8 total 2-star reviews7 total 1-star reviews
847 Reviews
Reviews for similar products
5 out of 5 stars rating
By Agnes A.12 March 2018Verified Purchase
All-Over-Print Leggings, M
Creator Review
I have so many leggings and I have to say when I felt this fabric I was amazed at the softness and how great it felt on my legs. I would recommend it to anyone as it is stretchy it’s durable and it does not lose its shape. Since I designed this and I loved the results I really wanted to have my own leggings, the print came out amazing the colors absolutely vibrant. I am satisfied as to who it was printed out and I recommend it without a second thought!
5 out of 5 stars rating
By Nicole W.12 March 2017Verified Purchase
All-Over-Print Leggings, M
Zazzle Reviewer Program
I absolutely love these leggings. The quality is great. I have not tried washing them yet, but hopefully they will last a long time. I bought small and I am 5ft 2" and size 8. They are long on me but that is normal; otherwise the fit is good. Design is exactly as expected and as the image showed.
5 out of 5 stars rating
By Roja K.7 February 2018Verified Purchase
All-Over-Print Leggings, M
Zazzle Reviewer Program
The leggings fit true to size and the fabric is comfortable and high quality without transparency. Great to wear for the gym or out in the the street! Flawless printing, very beautiful and flattering design.

Tags

Leggings
leggingsall over printbirdswildlifeanimalsvintageparrotstropicalexotic birds
All Products
leggingsall over printbirdswildlifeanimalsvintageparrotstropicalexotic birds

Other Info

Product ID: 256579313708620942
Created on 03/12/2016, 18:47
Rating: G