Tap / click on image to see more RealViewsTM
£9.45
per sheet of 20
 

Turtle Walking On Wet Beach Sand Square Sticker

Qty:
Square Stickers
+£0.35
+£0.35
+£0.35

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Turtle Walking On Wet Beach Sand Square Sticker

Turtle Walking On Wet Beach Sand Square Sticker

A sea turtle is walking on the wet sand of an ocean beach.

Customer Reviews

4.8 out of 5 stars rating27.3K Total Reviews
23628 total 5-star reviews2231 total 4-star reviews568 total 3-star reviews350 total 2-star reviews525 total 1-star reviews
27,302 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Tim S.23 October 2017Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
ocean sea waterbeachwetsandsea turtlewildlifereptilewalkinganimaltropical seashore
All Products
ocean sea waterbeachwetsandsea turtlewildlifereptilewalkinganimaltropical seashore

Other Info

Product ID: 256195116815421503
Created on 13/06/2025, 8:33
Rating: G