Tap / click on image to see more RealViewsTM
£2.73
per sticker
 

UH60 Blackhawk Frontal Clear Decal, 4" x 2.5"

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Tiny 5 cm x 5 cm

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalised stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 5.08 cm (2") L x 6.35 cm (2.5") H
  • Design Area: 5.08 cm (2") L x 5.08 cm (2") H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm (0.125") border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

UH60 Blackhawk Frontal Clear Decal, 4" x 2.5"

UH60 Blackhawk Frontal Clear Decal, 4" x 2.5"

Clear Vinyl Decal with a frontal view of a Blackhawk Helicopter (H-60).

Customer Reviews

4.6 out of 5 stars rating25 Total Reviews
21 total 5-star reviews2 total 4-star reviews0 total 3-star reviews1 total 2-star reviews1 total 1-star reviews
25 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kim K.7 July 2020Verified Purchase
Extra-Large 35.56 cm x 35.56 cm (14" x 14") Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Nice design and quality product. Excellent quality, exactly what was ordered
5 out of 5 stars rating
By Chandler A.23 August 2023Verified Purchase
Small 10.16 cm x 10.16 cm (4" x 4") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
The decal is perfect...it arrived ahead of schedule, was well priced and functions as a nice give away for our customers. It adheres well too. Chandler. Great job...the printing is very clear...
from zazzle.com (US)
5 out of 5 stars rating
By SAIR A.9 January 2025Verified Purchase
Large 20.32 cm x 20.32 cm (8" x 8") Sheet Custom-Cut Vinyl Stickers, Matte White
My first time trying Zazzle and Zazzle is amazing. The stickers are awesome and this is very good for business.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
uh 60uh60h60blackhawkstickerdecalflyarmyflyarmy
All Products
uh 60uh60h60blackhawkstickerdecalflyarmyflyarmy

Other Info

Product ID: 256386287272013575
Created on 18/11/2021, 11:37
Rating: G