Tap / click on image to see more RealViewsTM
£3.15
per sticker
 

UH60 Blackhawk Frontal Clear Decal, 4" x 2.5"

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Tiny 5 cm x 5 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 5 cm L x 2.12.7 cm W
  • Design Area: 5 cm L x 5 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

UH60 Blackhawk Frontal Clear Decal, 4" x 2.5"

UH60 Blackhawk Frontal Clear Decal, 4" x 2.5"

Clear Vinyl Decal with a frontal view of a Blackhawk Helicopter (H-60).

Customer Reviews

4.5 out of 5 stars rating26 Total Reviews
21 total 5-star reviews2 total 4-star reviews0 total 3-star reviews1 total 2-star reviews2 total 1-star reviews
26 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kim K.7 July 2020Verified Purchase
Extra-Large 35.56 cm x 35.56 cm (14" x 14") Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Nice design and quality product. Excellent quality, exactly what was ordered
5.0 out of 5 stars rating
5 out of 5 stars rating
By Chandler A.23 August 2023Verified Purchase
Small 10.16 cm x 10.16 cm (4" x 4") Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
The decal is perfect...it arrived ahead of schedule, was well priced and functions as a nice give away for our customers. It adheres well too. Chandler. Great job...the printing is very clear...
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By SAIR A.9 January 2025Verified Purchase
Large 20.32 cm x 20.32 cm (8" x 8") Sheet Custom-Cut Vinyl Stickers, Matte White
My first time trying Zazzle and Zazzle is amazing. The stickers are awesome and this is very good for business.
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
uh 60uh60h60blackhawkstickerdecalflyarmyflyarmy
All Products
uh 60uh60h60blackhawkstickerdecalflyarmyflyarmy

Other Info

Product ID: 256386287272013575
Created on 18/11/2021, 11:37
Rating: G