Tap / click on image to see more RealViewsTM
£7.45
per sheet of 20
 

US Route 2 Sign Square Sticker

Qty:
Square Stickers
+£0.35
+£0.35
+£0.35

Other designs from this category

About Stickers

Sold by

Shape: Square Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 7.6 cm diameter, 6 stickers per sheet
    • Small: 3.8 cm diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-colour, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

US Route 2 Sign Square Sticker

US Route 2 Sign Square Sticker

This is a real sign from US Route 2. Please visit our site. We have road signs from all states in the US. And a huge collection of cool & funny real signs, both American and international.

Customer Reviews

4.8 out of 5 stars rating27.2K Total Reviews
23577 total 5-star reviews2228 total 4-star reviews560 total 3-star reviews344 total 2-star reviews516 total 1-star reviews
27,225 Reviews
Reviews for similar products
5 out of 5 stars rating
By Anonymous8 September 2025Verified Purchase
Absolutely delighted with my custom jam labels, excellent quality & they look great. Thank you. .
5 out of 5 stars rating
By Carolyn S.17 August 2020Verified Purchase
Zazzle Reviewer Program
These stickers are great quality, they are of an adequate thickness the glue doesn’t leave a lot of residue if you need to peel it off. The size is perfect and the design has a softness with the beautiful flowers around the edges. The black lettering on the white background is sharp. It stands out beautifully. I love the Mixture of font styles as it catches the eye.
5 out of 5 stars rating
By Tim S.23 October 2017Verified Purchase
Zazzle Reviewer Program
Brilliant quality stickers perfect for Branding my business products. Perfect printing, excellent quality paper and finish.

Tags

Stickers
us 2nationalrouteapparelfreewayhighwaysystemroadtrafficsign
All Products
us 2nationalrouteapparelfreewayhighwaysystemroadtrafficsign

Other Info

Product ID: 217748044453416671
Created on 16/09/2015, 15:39
Rating: G