Tap / click on image to see more RealViewsTM
£27.55
per hat
 

veteran embroidered hat

Qty:
District Threads Distressed Chino Twill Cap
-£1.00
-£4.05
Light Olive

Other designs from this category

About Embroidered Hats

Sold by

Style: District Threads Distressed Chino Twill Cap

If you like the lived-in look, you'll love this enzyme-washed hat from District Threads. Comfortable as an old friend, it's 100% cotton and has an unstructured style with 6 panels and a low profile. Make it the perfect size with the metal D-ring slider buckle and hideaway cloth strap.

  • 100% cotton twill
  • Decoration style: digital embroidery
  • Low profile and unstructured
  • Metal D-ring slider buckle with hideaway strap closure
  • Due to a special finishing process, distress and colour may vary
  • Care instructions: machine wash cold, non-chlorine bleach when needed, tumble dry medium. Do not iron decorations or customisation

For some design guidance please see: How Do I Create a Design Suitable for Zazzle Embroidery

About This Design

veteran embroidered hat

veteran embroidered hat

veteran army

Customer Reviews

4.8 out of 5 stars rating1.2K Total Reviews
965 total 5-star reviews141 total 4-star reviews41 total 3-star reviews9 total 2-star reviews10 total 1-star reviews
1,166 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jane T.24 June 2012Verified Purchase
Embroidered Hat, District Threads Distressed Chino Twill Cap
Creator Review
I have a big head (it's all those brains, honest) so this fits me perfectly. I love how comfortably worn in this hat felt from the first time I wore it. Does the job. Beautifully done embroidery.
4 out of 5 stars rating
By G.2 March 2020Verified Purchase
Embroidered Hat, District Threads Distressed Chino Twill Cap
Creator Review
excellent quality of the cap and texture. very food the embroidery and quality
5 out of 5 stars rating
By Innocent P.1 October 2021Verified Purchase
Embroidered Hat, District Threads Distressed Chino Twill Cap
Zazzle Reviewer Program
It's super durable and the embroidery hasn't frayed or ripped at all! It's also adjustable in size! Super amazing. Hasn't come off or anything.
from zazzle.com (US)

Tags

Embroidered Hats
veteranarmyusanavyiraqafghanistansyriawarsoldier
All Products
veteranarmyusanavyiraqafghanistansyriawarsoldier

Other Info

Product ID: 233248223040733076
Created on 09/04/2019, 2:37
Rating: G