Tap / click on image to see more RealViewsTM
Sale Price £2.35.  
Original Price £3.13 per card
You save 25%

Viking Pattern Blue

Qty:
Squared
+£0.20
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-£0.17
+£0.68
+£0.68
+£1.58
+£0.68

About Flat Cards

Sold by

Size: 8.9 cm x 12.7 cm

Stand out with custom flat cards, turn this flat card into anything imaginable.

  • Dimensions: 8.89 cm x 12.7 cm (portrait or landscape)
  • High-quality, full-colour, full-bleed printing
  • Print on both sides for no additional cost
  • Add personal photos and text for free

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Viking Pattern Blue

Viking Pattern Blue

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating2.4K Total Reviews
2067 total 5-star reviews158 total 4-star reviews34 total 3-star reviews23 total 2-star reviews72 total 1-star reviews
2,354 Reviews
Reviews for similar products
5 out of 5 stars rating
By Maggie L.21 February 2021Verified Purchase
Flat Card, Size: 10.2 cm x 22.9 cm, Paper: Basic Semi-Gloss, Corner: Squared
Zazzle Reviewer Program
Since the lockdown, there were not many places to go to or to shop for gifts. That's, why gifting something personal and homemade to enjoy at home was a perfect idea. This Gift Voucher was easy to customize for my occasion and add all the detail I needed. The design is super cute and on a semi-gloss card, it looked high quality and really gorgeous and professional. Loved the small details with the hearts. Beautiful printing on a thick and professional sturdy card. Can recommend to always pick semigloss with Vouchers.
5 out of 5 stars rating
By Debra S.7 February 2017Verified Purchase
Flat Card, Size: 16.5 cm x 22.2 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
Beautiful, quality product, order numerous items for baby shower and all of exepctions quality, good delivery. Excellent range and choice, easy to personalise. Brilliant website/company, highly recommended. Excellent quality and finish. Extremely pretty, perfect.
3 out of 5 stars rating
By D.3 December 2021Verified Purchase
Flat Card, Size: 10.2 cm x 23.5 cm, Paper: Signature Matte, Corner: Squared
Zazzle Reviewer Program
Product is good quality overall however I am a bit disappointed about the front side, the background heart looks too blurry. You dont realise it when you upload it during creating your design, If the image quality wasn’t high like this, it should have not been accepted- or at least communicated to me. Also the corners of the card came chipped, and on a few backside images, I have a random white spot in my eye that is not on the real photo. Backside has brilliant clarity but front side’s image quality is very bad.

Tags

Flat Cards
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256091188921896013
Created on 17/11/2017, 22:18
Rating: G