Tap / click on image to see more RealViewsTM
£17.25
per bottle opener
 

Viking Pattern Blue

Qty:
Speed Bottle Opener
-£1.30
-£1.30

Other designs from this category

About Bottle Openers

Sold by

Style: Speed Bottle Opener

Pop those bottles like a pro! Used by bartenders, this professional stainless steel speed bottle opener has the length and design to open bottles with speed and ease. Customise yours with images, designs and text for a unique opener that shows off your style. Great as a gift for aspiring bartenders or for friends that like a good drink (or two)!

  • Dimensions: 3.8 cm w x 17.7 cm l x 0.3 cm h.
  • All over printing with protective coating.
  • Spinner ring included.
  • Stainless steel construction for extra durability.
  • Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 4 cm x 17.7 cm (1.6" x 7"). For best results please add 0.2 cm (1/11") bleed.

About This Design

Viking Pattern Blue

Viking Pattern Blue

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating231 Total Reviews
197 total 5-star reviews26 total 4-star reviews4 total 3-star reviews2 total 2-star reviews2 total 1-star reviews
231 Reviews
Reviews for similar products
5 out of 5 stars rating
By Gurpreet S.2 June 2020Verified Purchase
Speed Bottle Opener
Zazzle Reviewer Program
Brilliant item only Zazzle does this one good. Printing came out bang on no rubbish stuff
5 out of 5 stars rating
By L.25 June 2021Verified Purchase
Mini Bottle Opener With Key Ring
Zazzle Reviewer Program
I'm so pleased with this. The quality is excellent and it arrived earlier than expected (to the UK). Can't fault either. Would highly recommend. The printing was superb on a great quality product.
5 out of 5 stars rating
By J.12 November 2021Verified Purchase
Speed Bottle Opener
Zazzle Reviewer Program
Looks great, excellent quality. Exactly as expected. Personalisation perfect.

Tags

Bottle Openers
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256192524466145680
Created on 18/11/2017, 13:09
Rating: G