Tap / click on image to see more RealViewsTM
£59.85
per banner
 

Viking Pattern Blue Banner

Qty:
91cm x 152cm

Other designs from this category

About Banners

Sold by

Size: 91cm x 152cm Banner

Shout it from the rooftops, say it big and bold - it's time to get the word out! Indoors or out, our banners are here to help you advertise anything, from birthdays to graduation, weddings to anniversaries. We've got thousands of designs for you to browse through, along with 4 different size options.

  • Dimensions: 3'l x 5'w (horizontal) or 5'l x 3'w (vertical)
  • Edge-to-edge, full colour vibrant print for a bold statement
  • Hemmed and thermally welded edges for neat finish
  • Choice of indoor or outdoor banners. Outdoor banners can be bought with metal grommets

Material: Indoor

Lightweight and durable, our 368 g (13 oz) vinyl material is best suited for indoor or short-term outdoor events. This white flexible material comes with an elegant matte finish, and is both fade and tear resistant.

About This Design

Viking Pattern Blue Banner

Viking Pattern Blue Banner

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating2.2K Total Reviews
2064 total 5-star reviews86 total 4-star reviews32 total 3-star reviews14 total 2-star reviews37 total 1-star reviews
2,233 Reviews
Reviews for similar products
5 out of 5 stars rating
By Christelle S.1 September 2023Verified Purchase
Vinyl Banner, 76cm x 183cm, Indoor
Zazzle Reviewer Program
I needed a banner to advertise my small craft business. It was really easy to design it, to change colour, to add my logo and personalise it. The delivery was earlier that expected. I am impressed by the quality of the banner, it's coated and waterproof, it looks professional well finished, exactly what I was looking for. I am really pleased with my purchase and I recommend it . The design I created including my logo and the facebook/instagram icons look clear, in focus. Unfortunately, surely because I magnified my logo, a few pixels turned pink instead of black when you look very closely (see the leaves in the logo). It won't be an issue for me because it's not made to be seen so closely, it's more to be seen from a distance. All in all, I am pleased with the outcome.
5 out of 5 stars rating
By Ann K.30 March 2023Verified Purchase
Vinyl Banner, 91cm x 152cm, Indoor
Zazzle Reviewer Program
Arrived early than expected which was great. Material was great and fit perfectly for where it was being hanged up. Exactly as expected
5 out of 5 stars rating
By Yan Y.18 January 2022Verified Purchase
Vinyl Banner, 91cm x 152cm, Indoor
Zazzle Reviewer Program
It exactly what I want! Material is very good , no folded mark! Colour is same as what shows on my laptop.

Tags

Banners
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256325634972916561
Created on 20/11/2017, 11:22
Rating: G