Tap / click on image to see more RealViewsTM
£13.10
£6.55 each
 

Viking Pattern Blue Black Ink Pen

Qty:
Black
Black

Other designs from this category

About Pens

Sold by

Writing Ink Colour: Black Ink Pen

Just because we all have smart phones and laptops doesn't mean the written word is on its way out. In fact, it means just that much more to receive a personal handwritten note! Arm yourself with your own writing mechanism by customising your own one-of-a-kind pen, and continue to make statements in the good ol' fashioned way.

  • Minimum order of 2.
  • Click into action with your own one-of-a-kind pen.
  • Available in multiple color inks & trim accents.
  • Printed in full vibrant colour that is sure to wow.
  • Extended life writing cartridges.
  • Proudly made in the USA.
  • Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 10.2 cm x 3.4 cm (4.02" x 1.36"). For best results please add 0.6 cm (0.24") bleed.

About This Design

Viking Pattern Blue Black Ink Pen

Viking Pattern Blue Black Ink Pen

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating484 Total Reviews
412 total 5-star reviews49 total 4-star reviews10 total 3-star reviews6 total 2-star reviews7 total 1-star reviews
484 Reviews
Reviews for similar products
5 out of 5 stars rating
By Daphne L.9 January 2019Verified Purchase
Black Trim Pen, Black Ink
Zazzle Reviewer Program
Nicely made product, the plastic feels substantial and the matte finish works nicely with my design. Overall I'm very pleased with the quality. I recommend it as an addition to a personalized matching stationery set. Even though it's listed as a no grip, the texture on the design gives it traction when you write with it; a pleasant surprise. The printing is lovely, a little darker than expected and less sharp, but I love the texture with the printing which adds to its substantial feel without being heavy.
5 out of 5 stars rating
By Robert E.15 October 2020Verified Purchase
Black Trim Pen, Black Ink
Zazzle Reviewer Program
Such a great service!!! Great pens! Thanks you. Perfect Spot on. We love them.
5 out of 5 stars rating
By T.21 January 2023Verified Purchase
Black Trim Pen, Black Ink
Zazzle Reviewer Program
This was given as a gift. Great quality and perfect for any alien fans. I would recommend and will definitely buy again. The design and quality was perfect. This gift was very well received.

Tags

Pens
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256923905525289734
Created on 20/11/2017, 11:38
Rating: G