Tap / click on image to see more RealViewsTM
£13.25
each
 

Viking Pattern Blue Ceramic Knob

Qty:
Ceramic Knob

Other designs from this category

About Ceramic Pulls

Sold by

Style: Ceramic Knob

Spruce up cabinets and furniture and take your decorating game to the next level by customising your own knobs. From the kitchen to your child’s bedroom, custom knobs are the perfect accent that can complement any décor.

  • Beautiful 3.8 cm wide white ceramic knobs.
  • Standard size; fits most 3.2 cm diameter holes.
  • Easy installation.
  • Includes screw. No additional hardware required.
  • Great for cabinets, drawers, and furniture.
  • Perfect finishing touch to bedrooms, kitchens, DIY projects and more!
  • This product has small parts and is not a toy. Not recommended for children 8 and below.

About This Design

Viking Pattern Blue Ceramic Knob

Viking Pattern Blue Ceramic Knob

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating231 Total Reviews
207 total 5-star reviews13 total 4-star reviews2 total 3-star reviews2 total 2-star reviews7 total 1-star reviews
231 Reviews
Reviews for similar products
5 out of 5 stars rating
By N.8 January 2025Verified Purchase
Ceramic Knob
Absolut beautiful! Thanks a lot! Greatings from Finland. Good packaging. As described! Would recomend!10/10.
5 out of 5 stars rating
By Anonymous15 October 2025Verified Purchase
Ceramic Knob
Really gorgeous - pricey but very happy with the doorknobs I bought which appear to be very good quality. Thank you!
5 out of 5 stars rating
By E.27 October 2023Verified Purchase
Ceramic Knob
Zazzle Reviewer Program
Refurbishing our kitchen, we re-used some old Mexican drawer knobs we loved, but were short of four, so chose these as they looked as if they would happily co-exist with the old ones - and they do. Colour was very slightly lighter than the picture., but not enough to worry us.

Tags

Ceramic Pulls
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256139192633319931
Created on 18/11/2017, 12:54
Rating: G