Tap / click on image to see more RealViewsTM
£23.25
per ornament
 

Viking Pattern Blue Ceramic Tree Decoration

Qty:
  1. Style

  2. Add A Gift Pouch

Other designs from this category

About Ornaments

Sold by

Style: Ceramic Heart Ornament

Bring a lot more holiday cheer to your tree with a custom ceramic tree decoration. Add family photos, images and personal message to both sides of this tree decoration. A strand of gold thread makes it easy to hang this fantastic keepsake.

  • Dimensions: 7.6 cm l x 7.1 cm w; Weight: 39 g.
  • Made of white porcelain
  • Full-colour, full-bleed printing
  • Printing on both sides
  • Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 7.6 cm x 7.1 cm. For best results please add 0.3 cm (1/8") bleed.

About This Design

Viking Pattern Blue Ceramic Tree Decoration

Viking Pattern Blue Ceramic Tree Decoration

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating11.7K Total Reviews
9581 total 5-star reviews1293 total 4-star reviews380 total 3-star reviews175 total 2-star reviews289 total 1-star reviews
11,718 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Hyde S.19 December 2018Verified Purchase
Ceramic Heart Ornament
Zazzle Reviewer Program
ideal little gift for Christmas, does what it says on the tin. Very impressed - nice little design. As previewed.
3.0 out of 5 stars rating
3 out of 5 stars rating
By P G.14 October 2025Verified Purchase
Ceramic Heart Ornament
Nice, but my understanding pre-order was that the text would be double sided, which it wasn't. The text could have been clearer, and it did not come with a pouch which again I understood it would. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Wendy L.11 December 2019Verified Purchase
Ceramic Heart Ornament
Zazzle Reviewer Program
I got married on Anna Maria Island this year and we always get a Christmas Tree decoration from our travels, we didn't find one we loved so ordered this online when we got back, it is the exact picture of the location we got married and we love it, it has pride of place on our tree! Thank You. Great finish to the product! Great reminder of our wedding

Tags

Ornaments
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 175880270232656110
Created on 18/11/2017, 12:03
Rating: G