Tap / click on image to see more RealViewsTM
£23.25
per ornament
 

Viking Pattern Blue Ceramic Tree Decoration

Qty:
Ceramic Heart Ornament
-£3.75
-£3.75
-£3.75
-£5.00
-£5.00
-£5.00
-£1.25
-£1.25
-£1.25
+£6.25
+£6.25

Other designs from this category

About Ornaments

Sold by

Style: Ceramic Heart Ornament

Bring a lot more holiday cheer to your tree with a custom ceramic tree decoration. Add family photos, images and personal message to both sides of this tree decoration. A strand of gold thread makes it easy to hang this fantastic keepsake.

  • Dimensions: 7.6 cm l x 7.1 cm w; Weight: 39 g.
  • Made of white porcelain
  • Full-colour, full-bleed printing
  • Printing on both sides
  • Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 7.6 cm x 7.1 cm. For best results please add 0.3 cm (1/8") bleed.

About This Design

Viking Pattern Blue Ceramic Tree Decoration

Viking Pattern Blue Ceramic Tree Decoration

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating11.7K Total Reviews
9559 total 5-star reviews1291 total 4-star reviews376 total 3-star reviews174 total 2-star reviews282 total 1-star reviews
11,682 Reviews
Reviews for similar products
3 out of 5 stars rating
By P G.14 October 2025Verified Purchase
Ceramic Heart Ornament
Nice, but my understanding pre-order was that the text would be double sided, which it wasn't. The text could have been clearer, and it did not come with a pouch which again I understood it would. .
5 out of 5 stars rating
By Teddi B.14 December 2021Verified Purchase
Ceramic Heart Ornament
Zazzle Reviewer Program
After seeing the quality and speedy service I ended up ordering two more for the kid’s Christmas trees. Very impressive! Very professionally done!
from zazzle.com (US)
5 out of 5 stars rating
By S H.19 December 2018Verified Purchase
Ceramic Heart Ornament
Zazzle Reviewer Program
ideal little gift for Christmas, does what it says on the tin. Very impressed - nice little design. As previewed.

Tags

Ornaments
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 175880270232656110
Created on 18/11/2017, 12:03
Rating: G