Tap / click on image to see more RealViewsTM
£42.90
per cushion
 

Viking Pattern Blue Cushion

Qty:
Throw Cushion 40.6 x 40.6 cm (16" x 16")
+£21.30

About Cushions

Sold by

Size: Throw Cushion 40.6 x 40.6 cm (16" x 16")

Accent your home with custom cushions from Zazzle and make yourself the envy of the neighbourhood. Made from high-quality Simplex knit fabric, these 100% polyester cushions are soft and wrinkle-free. The heavyweight stretch material provides beautiful colour definition for your design while also being the perfect complement to your sofa!

  • Dimensions: 40.6 cm x 40.6 cm (square)
  • Simplex knit fabric; 100% polyester; wrinkle-free
  • Hidden zip enclosure; synthetic-filled insert included
  • Machine washable
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 40.6 cm. For best results, please add 1.5 cm bleed.

About This Design

Viking Pattern Blue Cushion

Viking Pattern Blue Cushion

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating9.5K Total Reviews
8212 total 5-star reviews893 total 4-star reviews184 total 3-star reviews72 total 2-star reviews97 total 1-star reviews
9,458 Reviews
Reviews for similar products
5 out of 5 stars rating
By Margaret S.31 March 2022Verified Purchase
Throw Cushion, Throw Cushion 40.6 x 40.6 cm (16" x 16")
Zazzle Reviewer Program
I had ordered this cushion with a picture of my friends dog who had just passed away ,I’ve ordered up some for my husband for Christmas and just so happy with the quality of the picture and colour plus very good padded cushions . Colours where fantastic just so vibrant and I just find them perfect
5 out of 5 stars rating
By Melanie O.20 August 2018Verified Purchase
Throw Cushion, Throw Cushion 40.6 x 40.6 cm (16" x 16")
Zazzle Reviewer Program
I designed this pillow as a birthday gift for my Mum from a pastel drawing of my own wedding bouquet. She wanted some of my artwork in her living room, so I decided to get it reproduced on something useful. The pillow is really soft and comfortable - perfect for her bad back. She absolutely loves it. I was a bit worried about print quality, but it was perfect. The definition of the pastel marks really came through and the colours are so vivid, it almost glows in the dark. The colour reproduction was spot on and the text on the back well-defined. Better than expected.
5 out of 5 stars rating
By L.16 November 2020Verified Purchase
Throw Cushion, Throw Cushion 40.6 x 40.6 cm (16" x 16")
Zazzle Reviewer Program
Would be better if you could select several photos at once from your own saved photos to save them on to the website rather than one at a time. Great quality in fact ordered 2 more of a different photo layout design for Christmas presents. Photos and photos of drawings my young nieces did on this cushion turned out perfect or I should say ‘purrrrrfect’ as they were all photos of their cats

Tags

Cushions
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 189479248306762464
Created on 18/11/2017, 10:38
Rating: G