Tap / click on image to see more RealViewsTM
£68.80
per fleece blanket
 

Viking Pattern Blue Fleece Blanket

Qty:

Other designs from this category

About Fleece Blankets

Sold by

Size: Fleece Blanket, 127 cm x 154.2 cm (50 in x 60 in)

It’s hard to cuddle by yourself. But with these fully customisable comfy fleece blankets, you won’t have to anymore. Customise the entire front panel and wrap yourself in personalised plush luxury. Delicate, soft and colourful, it's the perfect blanket for picnics in the park, outdoor events, and cozy winter snuggles.

  • Available in 3 different sizes: small 76.2 cm x 101.6 cm (30"x 40") medium 127 cm x 152.4 cm (50" x 60"); large 152.4 cm x 203.2 cm (60" x 80").
  • 100% buttery soft and cozy polyester fleece
  • Edge-to-edge sublimation printing in vibrant full colour
  • Sturdy double edge stitching for a clean finish
  • Back colour is off-white
  • Machine washable, gentle cycle, mild detergent
  • Tumble dry low
This product is recommended for ages 2+

About This Design

Viking Pattern Blue Fleece Blanket

Viking Pattern Blue Fleece Blanket

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating3.5K Total Reviews
3009 total 5-star reviews335 total 4-star reviews71 total 3-star reviews49 total 2-star reviews29 total 1-star reviews
3,493 Reviews
Reviews for similar products
5 out of 5 stars rating
By Marie s.3 March 2021Verified Purchase
Fleece Blanket, Small 76.2 cm x 101.6 cm (30" x 40")
Zazzle Reviewer Program
Treated myself to this beautiful blanket, put a photo of every dog I’ve ever looked after on it. Something I will keep forever. Thank you : ). I made little collages of 9 photo per square. I think photos would of been clearer if I had only put one photo per square. But that was my fault for adding hundred of photos : ) I love my blanket and would definitely buy another one!!
5 out of 5 stars rating
By S.15 November 2021Verified Purchase
Fleece Blanket, Medium 127 x 152.4 cm
Zazzle Reviewer Program
I was nervous to make the purchase without seeing one or feeling it but my goodness the quality is lovely! Please don’t hesitate to buy! So so pleased with this amazingly soft blanket. The personalised print is part of the fabric just as the pattern is, it doesn’t look like an addition, it looks gorgeous. Can’t wait to gift this to my mum at Xmas. Super fast delivery too. What can I say - I’m delighted. Thank you!!
5 out of 5 stars rating
By C.26 November 2020Verified Purchase
Fleece Blanket, Small 76.2 cm x 101.6 cm (30" x 40")
Zazzle Reviewer Program
As an owner of many Bernese mountain dogs I love it when I can buy a beautiful gift that is useful and has Bernese on it. I bought this Fleece Blanket as a gift for my friends new born baby boy. Absolutely love the turquoise colour and love even more that I could add that personal touch with the baby’s name. It can be really hard to find Bernese products that look good so when the product came I was super happy with the Quality and feel and turn out. The colour was just perfect I love the turquoise and the Bernese dogs are a nice shape and a good similarity to the breed. The printing Quality was fabulous. Exactly like what I’d made on the website.

Tags

Fleece Blankets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256478076938277373
Created on 18/11/2017, 12:45
Rating: G