Tap / click on image to see more RealViewsTM
£1.06  per flyer
£26.50 Subtotal
 

Viking Pattern Blue Flyer

Qty:
Thin Matte Paper
-£0.06

Other designs from this category

About Flyers

Sold by

Size: 21.6 cm x 27.9 cm (8.5" x 11")

Make your promotional materials stand out with a custom flyer. The perfect size for all of your promotional needs, you can upload your own photos, graphics, and logos to craft the perfect flyers for your event, party, or grand opening.

  • Dimensions: 8.5" L x 11" W
  • Larger than quarter-page size
  • High quality, full-color, full-bleed printing
  • Customize both sides at no extra cost
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 8.5" x 11". For best results please add 1/16" bleed

About This Design

Viking Pattern Blue Flyer

Viking Pattern Blue Flyer

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating859 Total Reviews
718 total 5-star reviews92 total 4-star reviews23 total 3-star reviews5 total 2-star reviews21 total 1-star reviews
859 Reviews
Reviews for similar products
5 out of 5 stars rating
By Lisa C.27 February 2020Verified Purchase
Flyer Paper, Size: 13 cm x 21.6 cm (5.5" x 8.5"), Paper: Thin Matte Paper
Zazzle Reviewer Program
Absolutely love these flyers and I will be reordering them for every event in the future. Don’t hesitate to buy these, quality and design is perfect x. Good quality well printed flyers-highly recommend
5 out of 5 stars rating
By Renata A.3 June 2021Verified Purchase
Flyer Paper, Size: 21.6 cm x 27.9 cm (8.5" x 11"), Paper: Thin Matte Paper
Zazzle Reviewer Program
I thought this product was amazing. The prints were amazing, will definitely be ordering more, so happy with the outcome.
5 out of 5 stars rating
By Erika W.13 October 2015Verified Purchase
Flyer Paper, Size: 21.6 cm x 27.9 cm (8.5" x 11"), Paper: Thin Glossy Paper
Zazzle Reviewer Program
this is an excellent flyer, but if you are like me and thought the tear-off strips are already perforated then beware, they are not !! I had to go and buy a special tool for the job. Also the card I chose (can't remember selecting anything other than 'basic') is very thick, too thick for a standard flyer I would say. *NOTE order way in advance, takes ages to arrive. Great design, print colours are very similar to that shown on the computer, which is unusual in my experience, so this is a big bonus. This is the 3rd I've chosen from PetPro Designs and Dolores the designer is so helpful! I have now ordered more small flyers and some postcards.

Tags

Flyers
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 244564746715675103
Created on 20/11/2017, 11:48
Rating: G