Tap / click on image to see more RealViewsTM
£22.60
per spiral notebook
 

Viking Pattern Blue Notebook

Qty:
21.59 cm x 27.94 cm (8.5" x 11") Deluxe Spiral Notebook
Wide Ruled
Black

Other designs from this category

About Spiral Notebooks

Sold by

Style: 21.59 cm x 27.94 cm (8.5" x 11") Deluxe Spiral Notebook

Accessorise while you organise with these hand made spiral notebooks. The front and back covers are customisable with your images and text, and the notebook covers are laminated to ensure durability. Choose from 4 notebook styles, hardcover or softcover versions, 7 different spiral colours and 10 page design options to make your one-of-a-kind notebook today.

  • Dimensions: 21.6 cm l x 28 cm w (8.5" l x 11" w)
  • Hardcover or Softcover
  • Page Count: 60 sheets, 120 pages
  • 60 lb. durable text smooth paper
  • Laminated front and back covers, plain white inside
  • Choice of 7 colours for the spiral
  • Choice of 10 designs for the pages
  • CPSIA compliant
  • Suitable for ages 4+

About This Design

Viking Pattern Blue Notebook

Viking Pattern Blue Notebook

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating791 Total Reviews
719 total 5-star reviews54 total 4-star reviews6 total 3-star reviews3 total 2-star reviews9 total 1-star reviews
791 Reviews
Reviews for similar products
5 out of 5 stars rating
By Katie B.2 December 2021Verified Purchase
21.59 cm x 21.59 cm (8.5" x 8.5") Deluxe Spiral Notebook, Black spiral, College Ruled pages
Zazzle Reviewer Program
Lovely design, I liked how I was able to personalise every element. printed perfectly. Nice and glossy front page, the pages inside are a little warped but that could be to do with the weather however I don't feel it ruins the notepad.
5 out of 5 stars rating
By Mey A.2 October 2022Verified Purchase
21.59 cm x 21.59 cm (8.5" x 8.5") Deluxe Spiral Notebook, Grey spiral, Sketch pages
Creator Review
I have loved the concept of a double sided notebook for years, and usually I would have to make them myself from a simple notebook, but this was amazing and right on the point ! Perfect printing quality, love the colors
5 out of 5 stars rating
By Rebecca m.26 January 2024Verified Purchase
21.59 cm x 27.94 cm (8.5" x 11") Deluxe Spiral Notebook, Gold spiral, College Ruled pages
Zazzle Reviewer Program
Absolutely loved this book to start my wedding plans in. The book was a great size a the delivery was quick. Print came out great. Really happy with it.

Tags

Spiral Notebooks
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256901698435672199
Created on 19/11/2017, 10:12
Rating: G