Tap / click on image to see more RealViewsTM
Sale Price £16.00.  
Original Price £2.35per paper plate. Sale Price £2.00per paper plate.
You save 15%

Viking Pattern Blue Paper Plate

Qty:
17.8 cm Round Paper Plate
+£0.10
+£0.10

Other designs from this category

About Paper Plates

Sold by

Size and Style: 17.8 cm Round Paper Plate

Throw a spectacular party with fully customisable paper plates to match your theme! Each set of eight paper plates is printed on durable paper stock and decorated with your custom designs or photos. These plates are perfect for serving cake, appetizers, or salads. Order these with our paper napkins for a complete set of party tableware that your guests will love!

  • Dimensions: 17.78 cm (7" diameter)
  • FDA compliant for food contact safety
  • Perfect for cake, appetisers, or salads
  • Printed in USA

About This Design

Viking Pattern Blue Paper Plate

Viking Pattern Blue Paper Plate

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.5 out of 5 stars rating1.4K Total Reviews
1141 total 5-star reviews105 total 4-star reviews52 total 3-star reviews47 total 2-star reviews89 total 1-star reviews
1,434 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Alegria D.3 January 2023Verified Purchase
Paper Plates, 22.9 cm Round Paper Plate
Zazzle Reviewer Program
Absolutely love them! Arrived before than expected and it’s like the preview. Perfect. It’s exactly as the preview.
5.0 out of 5 stars rating
5 out of 5 stars rating
By P.20 March 2018Verified Purchase
Paper Plates, 17.8 cm Round Paper Plate
Zazzle Reviewer Program
Perfect great for 1st birthday. Well worth money was just what u was after
5.0 out of 5 stars rating
5 out of 5 stars rating
By Iliana C.25 October 2022Verified Purchase
Paper Plates, 22.9 cm Round Paper Plate
Zazzle Reviewer Program
great quality, durable. as per picture , great colors

Tags

Paper Plates
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256625107117526098
Created on 18/11/2017, 11:39
Rating: G