Tap / click on image to see more RealViewsTM
£11.60
per pad
 

Viking Pattern Blue Post-it Notes

Qty:
10.2 x 7.6 cm
+£7.30
-£1.45
+£20.40

Other designs from this category

About Post-it® Notes

Sold by

Size: Post-it® Notes 10.2 cm x 7.6 cm (4" x 3")

When your mind is brimming with to-dos, keep it together with a pad of custom 3M Post-it® Notes. Jot down urgent memos, lists, or a sweet note to special someone such as, "Do NOT forget the milk!" Each 10.1 cm x 7.6 cm pad comes with 50 sticky notes printed in full colour with your graphics, text, or photos. If Post-it® Notes are going to be on your desk anyway, they might as well be creatively personal.

  • Authentic 3M Post-it® Notes
  • Dimensions: 10.1 cm x 7.6 cm (Adhesive side: 10.1 cm edge)
  • Printed in full colour on 50-sheet white Post-it® Notes paper
  • Buy in bulk and save
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 10.1 cm x 7.1 cm. For best results please add 0.15 cm (.12") bleed..

About This Design

Viking Pattern Blue Post-it Notes

Viking Pattern Blue Post-it Notes

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating2K Total Reviews
1714 total 5-star reviews179 total 4-star reviews34 total 3-star reviews9 total 2-star reviews19 total 1-star reviews
1,955 Reviews
Reviews for similar products
5 out of 5 stars rating
By L.10 March 2020Verified Purchase
Post-It® Notes, 10.2 x 7.6 cm
Zazzle Reviewer Program
The product is well done and the design has been quite easy. The printing is as good as I expected.
5 out of 5 stars rating
By Laura M.18 June 2021Verified Purchase
Post-It® Notes, 7.6 x 7.6 cm
Zazzle Reviewer Program
It was very easy to upload my design and have these produced. They came a tiny bit late but still in enough time for when I needed them. The paper is super smooth and lovely to write on. Just as I hoped it’s be. Nice finish on them.
5 out of 5 stars rating
By Neringa L.14 November 2020Verified Purchase
Post-It® Notes, 7.6 x 7.6 cm
Zazzle Reviewer Program
5-star service and the product. Totally enjoy it. delivery was quick too. easy to write with any pen. printing is perfect.

Tags

Post-it® Notes
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256866823467017474
Created on 19/11/2017, 10:08
Rating: G