Tap / click on image to see more RealViewsTM
£11.60
per pad
 

Viking Pattern Blue Post-it Notes

Qty:
  1. Size

Other designs from this category

About Post-it® Notes

Sold by

Size: Post-it® Notes 10.2 cm x 7.6 cm (4" x 3")

When your mind is brimming with to-dos, keep it together with a pad of custom 3M Post-it® Notes. Jot down urgent memos, lists, or a sweet note to special someone such as, "Do NOT forget the milk!" Each 10.1 cm x 7.6 cm pad comes with 50 sticky notes printed in full colour with your graphics, text, or photos. If Post-it® Notes are going to be on your desk anyway, they might as well be creatively personal.

  • Authentic 3M Post-it® Notes
  • Dimensions: 10.1 cm x 7.6 cm (Adhesive side: 10.1 cm edge)
  • Printed in full colour on 50-sheet white Post-it® Notes paper
  • Buy in bulk and save
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 10.1 cm x 7.1 cm. For best results please add 0.15 cm (.12") bleed..

About This Design

Viking Pattern Blue Post-it Notes

Viking Pattern Blue Post-it Notes

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating2K Total Reviews
1720 total 5-star reviews181 total 4-star reviews35 total 3-star reviews9 total 2-star reviews21 total 1-star reviews
1,966 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Laura M.18 June 2021 • Verified Purchase
Post-It® Notes, 7.6 x 7.6 cm
Zazzle Reviewer Program
It was very easy to upload my design and have these produced. They came a tiny bit late but still in enough time for when I needed them. The paper is super smooth and lovely to write on. Just as I hoped it’s be. Nice finish on them.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Neringa L.14 November 2020 • Verified Purchase
Post-It® Notes, 7.6 x 7.6 cm
Zazzle Reviewer Program
5-star service and the product. Totally enjoy it. delivery was quick too. easy to write with any pen. printing is perfect.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sue R.18 December 2019 • Verified Purchase
Post-It® Notes, 10.2 x 7.6 cm
Zazzle Reviewer Program
Highly delighted with post it pad, good quality paper, perfect for my new post it pad holder, definitely would buy again. Fast delivery to the UK. Better than expected.

Tags

scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256866823467017474
Created on 19/11/2017, 10:08
Rating: G