Tap / click on image to see more RealViewsTM
£30.50
per wood art stamp
 

Viking Pattern Blue Rubber Stamp

Qty:
Wooden Handle
-£1.70
None
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55
+£14.55

Other designs from this category

About Wood Art Stamps

Sold by

Size: 2" x 2" / 5 cm x 5 cm

Transform any craft project with a personalised maple wood stamp. Leave an impression by uploading a design, image, pattern, or text to make your unique stamp.

  • Available in six sizes
  • Laser engraved on foam cushion
  • Optional wooden handle
  • Optional Colour Box® ink pad is permanent ink for scrapbooking and paper craft projects
  • Additional Colour Box® ink pads in a variety of colours can be found by following this Link
  • Ink pad size: 10.16 cm L x 6.35 cm W x 1.27 cm D (4" x 2.5" x 0.5")
  • Raised pad surface
This product is recommended for ages 13+

About This Design

Viking Pattern Blue Rubber Stamp

Viking Pattern Blue Rubber Stamp

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating3.1K Total Reviews
2645 total 5-star reviews250 total 4-star reviews69 total 3-star reviews49 total 2-star reviews66 total 1-star reviews
3,079 Reviews
Reviews for similar products
5 out of 5 stars rating
By Alisha M.3 March 2021Verified Purchase
Zazzle Reviewer Program
I absolutely love my stamp from Zazzle, it took a while to arrive but there was tracking so I was aware that there would be a delay due to the recent US snowstorms. My stamp is beautiful perfectly etched out on the stamp and a lovely engraved image of my stamp on the top, my only regret it not buying more! I've received so many compliments about my stamp! Perfect, exactly like the image I supplied
5 out of 5 stars rating
By antony m.6 August 2020Verified Purchase
Zazzle Reviewer Program
Ordered this, not expecting it to arrive very quickly as it came from America - took only a few days. It's fantastic - it prints even the smallest details of our design. Very happy. Will use again for sure. Excellent- very impressed.
5 out of 5 stars rating
By Isabel G.15 September 2020Verified Purchase
Zazzle Reviewer Program
Really great product super clear. Nice quality and easy to use. Fabulous really clear and crisp.

Tags

Wood Art Stamps
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256160543776141113
Created on 20/11/2017, 11:38
Rating: G