Tap / click on image to see more RealViewsTM
Sale Price £28.31.  
Original Price £33.30 per wood art stamp
You save 15%

Viking Pattern Blue Rubber Stamp

Qty:
  1. Size

  2. Handle

  3. Ink Pad colour: None

Other designs from this category

About Wood Art Stamps

Sold by

Size: 2" x 2" / 5 cm x 5 cm

Put your mark on it. Upload a design, logo, pattern, or text to create a custom maple wood stamp that's all yours. Laser-engraved on a foam cushion for crisp, clean impressions every time. Great for scrapbooking, card making, gift tags, packaging, and any paper craft that needs a personal touch.

  • Available in six sizes
  • Optional wooden handle for easier stamping
  • Optional Color Box® permanent ink pad (10.2 cm L x 1.3 cm W x 6.4 cm H, raised pad surface)
  • Additional Color Box® ink pad colors available here
This product is recommended for ages 13+

About This Design

Viking Pattern Blue Rubber Stamp

Viking Pattern Blue Rubber Stamp

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating3.2K Total Reviews
2690 total 5-star reviews253 total 4-star reviews73 total 3-star reviews59 total 2-star reviews79 total 1-star reviews
3,154 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Alisha M.3 March 2021 • Verified Purchase
1" x 1" / 2.5 cm x 2.5 cm Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Horizontal, Handle = No Handle
Zazzle Reviewer Program
I absolutely love my stamp from Zazzle, it took a while to arrive but there was tracking so I was aware that there would be a delay due to the recent US snowstorms. My stamp is beautiful perfectly etched out on the stamp and a lovely engraved image of my stamp on the top, my only regret it not buying more! I've received so many compliments about my stamp! Perfect, exactly like the image I supplied
5.0 out of 5 stars rating
5 out of 5 stars rating
By morgan a.6 August 2020 • Verified Purchase
4" x 5" / 10.1 cm x 12.7 cm Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Vertical, Handle = Wooden Handle
Zazzle Reviewer Program
Ordered this, not expecting it to arrive very quickly as it came from America - took only a few days. It's fantastic - it prints even the smallest details of our design. Very happy. Will use again for sure. Excellent- very impressed.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Isabel G.15 September 2020 • Verified Purchase
1" x 1" / 2.5 cm x 2.5 cm Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Horizontal, Handle = No Handle
Zazzle Reviewer Program
Great product. Considering that the stamp is quite dainty the image is and quality is lovely. Very easy and comfortable to use. Great, very crisp and clear

Tags

scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256160543776141113
Created on 20/11/2017, 11:38
Rating: G