Tap / click on image to see more RealViewsTM
£75.05
per skateboard
 

Viking Pattern Blue Skateboard

Qty:

Other designs from this category

About Skateboards

Sold by

Deck Type: 7 3/4" Skateboard Deck

Whether you're doing grinds on the half-pipe or kickflips in the street, this competition-shaped board has excellent pop! Our decks are crafted from the finest quality hard-rock maple, and with our unique printing process, you get the best skateboard available worldwide.

  • Professional quality skateboard deck made from the highest quality materials
  • Seven plies of premium USA Maple sourced from the Great Lakes region
  • Skateboard-specific glue from Franklin.

Complete Your Board: None

Order yourself the complete board. We add Krux or Independent trucks (based on deck style), Bullet bearings, Ricta wheels, grip tape and mounting hardware.

About This Design

Viking Pattern Blue Skateboard

Viking Pattern Blue Skateboard

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating181 Total Reviews
158 total 5-star reviews15 total 4-star reviews2 total 3-star reviews2 total 2-star reviews4 total 1-star reviews
181 Reviews
Reviews for similar products
5 out of 5 stars rating
By Amelia P.4 August 2019Verified Purchase
7 3/4" Skateboard Deck
Zazzle Reviewer Program
Amazing! Im setting my own line of merchadise for my art to have at art fairs and exhibtions. Brilliant quailty my designs are accuratly printed <3 so much love for this. Thanks @the_lost_artisttt. Bright perfect colours were just how they show
5 out of 5 stars rating
By Amelia P.4 August 2019Verified Purchase
7 3/4" Skateboard Deck
Zazzle Reviewer Program
Amazing! Im setting my own line of merchadise for my art to have at art fairs and exhibtions. Brilliant quailty my designs are accuratly printed <3 so much love for this. Thanks @the_lost_artisttt. Colours bold excatly how I wanted, very vibrant super accurate to my design. Perfect!
5 out of 5 stars rating
By B.23 May 2012Verified Purchase
7 3/4" Skateboard Deck
Creator Review
The quality of the product is great. I do recommend it. Love the Board and the Design. The print was top notch, very clear and bright.

Tags

Skateboards
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 186963021895698856
Created on 18/11/2017, 16:53
Rating: G