Tap / click on image to see more RealViewsTM
£25.25
per stocking
 

Viking Pattern Blue Small Christmas Stocking

Qty:
Small
Brushed Poly
Red Back Panel

Other designs from this category

About Christmas Stockings

Sold by

Size: Christmas Stocking 23 cm x 41 cm (9" x 16")

Stop Santa in his tracks this year with fabulous one-of-a-kind stockings. Made from bright and vividly printed polyester, these stockings are too pretty for coal. Give holiday cheer when you gift a 100% personalised stocking decorated with favourite pictures, treasured memories, cherished quotes, and more. The perfect addition to brighten any holiday mantle decor.

  • Dimension: 22.8 cm x 40.6 cm
  • Material: Available in 3 different styles; all 100% polyester
  • Sturdy sewn-in loop for hanging
  • Machine washable, lay flat to dry
  • Made in USA

About This Design

Viking Pattern Blue Small Christmas Stocking

Viking Pattern Blue Small Christmas Stocking

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating421 Total Reviews
345 total 5-star reviews59 total 4-star reviews9 total 3-star reviews5 total 2-star reviews3 total 1-star reviews
421 Reviews
Reviews for similar products
5 out of 5 stars rating
By Alana S.10 October 2019Verified Purchase
Red Back Panel Christmas Stocking, Brushed Poly
Zazzle Reviewer Program
I absolutely love the stocking , it’s brilliant quality the picture is so clear and even the stocking itself is good quality. Very good so satisfied with the picture it’s very clear and looks exactly like the picture
5 out of 5 stars rating
By H.7 October 2022Verified Purchase
Red Back Panel Christmas Stocking, Brushed Poly
Zazzle Reviewer Program
This product is absolutely amazing it looks exactly like my cairn terrier!! I love that it's so unique I've not seen anything like this on the UK market. Brilliant print exactly as expected
5 out of 5 stars rating
By Elen P.4 January 2020Verified Purchase
Red Back Panel Christmas Stocking, Brushed Poly
Zazzle Reviewer Program
Beautiful, my son enjoyed it very much. True to design, what you see is what you get

Tags

Christmas Stockings
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256886378358240183
Created on 18/11/2017, 12:42
Rating: G