Tap / click on image to see more RealViewsTM
£11.00
£1.10 per sheet
 

Viking Pattern Blue Stationery

Qty:
Thin Matte Paper

4.1pt thickness / 80 lb weight
Crisp white, matte finish

+£0.14
+£0.14
+£0.14

Other designs from this category

About Stationery

Sold by

Size: 14 cm x 21.6 cm

The paper you write on can say just as much as the words written on it, so make your notes stand out with stationery for your home and office. Choose from 5 different paper types and write letters and business correspondence that will make everyone take notice!

  • 21.6 cm l x 14 cm w (portrait) or 14 cm l x 21.6 cm w (landscape)
  • Choice of five paper types
  • High quality, full-colour, full-bleed printing
  • Creator Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 14 cm x 21.6 cm. For best results please add 1.5 mm bleed

Paper Type: Thin Matte Paper

Your business and personal mailings will have a crisp professional look on this matte. Contains 50% recycled content (10% post-consumer and 40% pre-consumer waste).

About This Design

Viking Pattern Blue Stationery

Viking Pattern Blue Stationery

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating399 Total Reviews
328 total 5-star reviews42 total 4-star reviews19 total 3-star reviews5 total 2-star reviews5 total 1-star reviews
399 Reviews
Reviews for similar products
5 out of 5 stars rating
By Daphne L.9 January 2019Verified Purchase
Stationery Paper, Size: 14 cm x 21.6 cm, Paper: Thin Matte Paper, Envelopes: None
Zazzle Reviewer Program
This linen paper combined with my design and the printing is more beautiful than I expected. This was a test run which I learned a great deal on (how important it is to wear my glasses!). It feels lovely to the touch; the texture is irresistable, perfect for finely printed wedding invites and announcements. The design is exactly like the photo mock up, the colors, crispness, etc, I couldn't be happier. I recommend customers that make these from scratch to use a template for accurateness of measurements and distances, another valuable lesson learned from my test run!
5 out of 5 stars rating
By Isabel C.27 November 2020Verified Purchase
Stationery Paper, Size: 14 cm x 21.6 cm, Paper: Thin Matte Paper, Envelopes: None
Zazzle Reviewer Program
I thought the notepaper was very good. Printing ok but not as good as l
5 out of 5 stars rating
By X.16 November 2019Verified Purchase
Stationery Paper, Size: 14 cm x 21.6 cm, Paper: Thin Matte Paper, Envelopes: None
Zazzle Reviewer Program
So nice to be able to use my designs on some writing paper to give as a present. Really great.good quality paper.

Tags

Stationery
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 229486491158181475
Created on 18/11/2017, 12:08
Rating: G